PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0010ss01910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 246aa    MW: 27187.8 Da    PI: 6.8558
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0010ss01910.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.71.7e-42791781100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r da++s+vyeA ar+rdPvyG++g i +lq+q+++l+a
  Vang0010ss01910.1  79 PCAACKILRRRCAEKCVLAPYFPPTEPAKFTIAHRVFGASNIIKFLQELPESQRADAVTSMVYEASARIRDPVYGCAGAICQLQKQVNELQA 170
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        +la+ ++e
  Vang0010ss01910.1 171 QLAKSQAE 178
                        ***99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.37978179IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-4279176IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
PSHKHTLFFF LSFFVSLKHD TTREQKHTKE QTNKQTRLET EMESSDTYTP TSSAPLSHSP  60
TSSSSSPPPP PPPTVVMSPC AACKILRRRC AEKCVLAPYF PPTEPAKFTI AHRVFGASNI  120
IKFLQELPES QRADAVTSMV YEASARIRDP VYGCAGAICQ LQKQVNELQA QLAKSQAELV  180
TMQLQQANLV ALICMEMAQS PQESPQQSVD NFISTPPHTG GYQSGVNNFF EENTSPNSLW  240
EPLWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-417818010112LOB family transfactor Ramosa2.1
5ly0_B6e-417818010112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0010ss01910.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017432444.11e-149PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9SK084e-76LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0L9V6W41e-148A0A0L9V6W4_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SCU31e-148A0A0S3SCU3_PHAAN; Uncharacterized protein
STRINGXP_007132174.11e-119(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.15e-78LOB domain-containing protein 11