PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0010ss01670.1
Common NameLR48_Vigan238s001700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family WOX
Protein Properties Length: 190aa    MW: 20857.3 Da    PI: 4.3827
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0010ss01670.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.41.5e-102156337
                       --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC CS
           Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl 37
                       +R+++tkeq++ Le+l+++  ++psaee+++++++l
  Vang0010ss01670.1 21 SRWNPTKEQITMLENLYKQgIKTPSAEEIQQITARL 56
                       7*****************99**************99 PP

2Wus_type_Homeobox60.34.3e-201960243
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyG 43
                       a++RW+Pt+eQi++Le+lyk+G++tP++eeiq+ita+L++yG
  Vang0010ss01670.1 19 ASSRWNPTKEQITMLENLYKQGIKTPSAEEIQQITARLRAYG 60
                       689**************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF000463.1E-82156IPR001356Homeobox domain
CDDcd000860.004072256No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MEESGNEELE MGGSNGVAAS SRWNPTKEQI TMLENLYKQG IKTPSAEEIQ QITARLRAYG  60
LCPPYCIPQV QSENGFYPPH PKVLVPVGFR RRPSEIFVPT DMSNVISNGP LLYEGMQQRI  120
SDCNLSYSNQ ETLDLFPLHP TGILEGKTTY QVSSLASVSA DSSTDINEND PSPLNKPFFD  180
FFTTSGQGS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0010ss01670.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017406237.11e-128PREDICTED: WUSCHEL-related homeobox 2
TrEMBLA0A0L9T7W41e-127A0A0L9T7W4_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SD621e-127A0A0S3SD62_PHAAN; Uncharacterized protein
STRINGXP_007132075.11e-101(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.14e-21WUSCHEL related homeobox 2
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]