PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0010ss00350.1
Common NameLR48_Vigan08g176800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family GATA
Protein Properties Length: 306aa    MW: 33691.3 Da    PI: 4.9253
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0010ss00350.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.68.1e-19222255134
               GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                        Cs+C++ kTp+WR gp g+ktLCnaCG+++++ +
  Vang0010ss00350.1 222 CSHCQVQKTPQWRTGPLGPKTLCNACGVRFKSGR 255
                        *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169929.9E-813304IPR016679Transcription factor, GATA, plant
SuperFamilySSF577165.23E-14214277No hitNo description
SMARTSM004013.2E-14216270IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.227216252IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.9E-14220253IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.34E-14221278No hitNo description
PROSITE patternPS003440222247IPR000679Zinc finger, GATA-type
PfamPF003201.6E-16222255IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MEVAAAEALK TSLRTEFIFP QAICDEIFCF NANNIVVGED FSVDDLLDFS NGEFQLGKDF  60
DVYEEEEDEE KDSTSGSSQD RTEDDSNSNS TAGGGVGDSD SVFAGELSVP ADDVADLEWV  120
SHFVDDSLPE LSLLYPVPTE QTRVWAEAKP RPGRAQNGSA IPRRPRTGKS RKPNARVWSF  180
TVSPPSLCFS VLAGSVEFGE PTAKKQKKKA EAQIGTQFQR RCSHCQVQKT PQWRTGPLGP  240
KTLCNACGVR FKSGRLFPEY RPACSPTFSG DIHSNSHRKV LEMRRRKETS EPQTGSDRPQ  300
LVPSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014492528.10.0PREDICTED: GATA transcription factor 7-like
RefseqXP_014492524.10.0PREDICTED: GATA transcription factor 7-like
TrEMBLA0A0L9V7C50.0A0A0L9V7C5_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SDS40.0A0A0S3SDS4_PHAAN; Uncharacterized protein
STRINGGLYMA12G04180.21e-149(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.14e-52GATA transcription factor 7
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]