PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0005s01160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 280aa    MW: 30719.6 Da    PI: 10.5214
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0005s01160.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.98.2e-32120175156
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       k+r++W++eLH+rF++a++qLGG++ AtPk+i+elmkv+gLt+++vkSHLQk+Rl+
  Vang0005s01160.1 120 KQRRCWSQELHKRFLHALQQLGGADSATPKQIRELMKVDGLTNDEVKSHLQKFRLH 175
                       79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.094117177IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-28117178IPR009057Homeodomain-like
SuperFamilySSF466892.15E-18117178IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-27120175IPR006447Myb domain, plants
PfamPF002497.8E-7122172IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MLPRKMGFRE YIEALEEERR KIQVFPKELP LSSVQLWNSN PPPTKEDVPR KANVVEVKRN  60
GGAFQPFQRE EKSAIVNGKA DNYASAIGKT PSSPPVPATS STGPITIDSR KEEKGQTQRK  120
QRRCWSQELH KRFLHALQQL GGADSATPKQ IRELMKVDGL TNDEVKSHLQ KFRLHTRRSP  180
IIHNNGNSQA APLFLVGKIF VQPPEYGAVA TSTASGGELT TVTAPTGIYA PVAAHPPLVT  240
NTPIMNHSRS QERPNYNNNN SAQSNSPASS SSTHTITTT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0005s01160.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017426139.10.0PREDICTED: myb family transcription factor EFM-like
TrEMBLA0A0L9UT120.0A0A0L9UT12_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T1900.0A0A0S3T190_PHAAN; Uncharacterized protein
STRINGXP_007153350.11e-148(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39183363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.13e-47G2-like family protein