PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0004ss00720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family Trihelix
Protein Properties Length: 290aa    MW: 32665.3 Da    PI: 7.7622
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0004ss00720.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix33.98.5e-1117603679
           trihelix 36 kkmrergferspkqCkekwenlnkrykkikegekkrtsessstc 79
                       +  r++g+ rs++qC++kw+nl ++ykk+++ e  ++s sss+ 
  Vang0004ss00720.1 17 SMARDHGCLRSQNQCNDKWDNLLRDYKKVRDYEATKSSSSSSHL 60
                       55699*****************************9977777654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138378.5E-71859No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MSEPNLPPPD PTFYPSSMAR DHGCLRSQNQ CNDKWDNLLR DYKKVRDYEA TKSSSSSSHL  60
SNNNQFQFQS YWTMEKHQRK EHKLPSNMLL QVYQAVTQVL QKKSHTSQLH HHHQHHFVNV  120
VHSPPQEHPQ VTPLLTSTSQ PLSQTTPAAS QPLLLLPPPS LPPRPVDSTT PPVSEGSESS  180
GTECKNDDEN SESKRRKFEQ KLGSSIMRSA SELAQALRSC EEKKEKRHQE MMELHRRGLH  240
IEETRNQVNQ QGITNLVSAV TNLTGVIQSF ITMNKDHGAG NADDHACSS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0004ss00720.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017426405.10.0PREDICTED: uncharacterized protein LOC108334997
TrEMBLA0A0L9UTF50.0A0A0L9UTF5_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T0P90.0A0A0S3T0P9_PHAAN; Uncharacterized protein
STRINGXP_007153114.11e-116(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68043242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31310.15e-23Trihelix family protein