PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0004ss00660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 283aa    MW: 32254 Da    PI: 8.6982
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0004ss00660.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.81.4e-291970253
            G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53
                       prlrWtpeLH++Fv a+e LGG++kAtPk +l+lm+vkgLt++hvkSHLQ +
  Vang0004ss00660.1 19 PRLRWTPELHRCFVYAIETLGGHHKATPKLVLQLMDVKGLTISHVKSHLQLF 70
                       8*************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.5361575IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-271573IPR009057Homeodomain-like
SuperFamilySSF466891.97E-151776IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-221972IPR006447Myb domain, plants
PfamPF002495.3E-62068IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MGSCGREGVV RQYIRSKVPR LRWTPELHRC FVYAIETLGG HHKATPKLVL QLMDVKGLTI  60
SHVKSHLQLF FLFFKNNQMY RSMKGDSCRQ GTKRCSFDLL YCKTLCLFNT FSYPHLPMLC  120
VHKVDKTSTQ HRKQHDDEVG DVGFYSCFKS IGKESDSQPS CSNFSLKRAR IEKTSFLSGF  180
PQCSQRNPYT TFYDYLQSMA EQKGIKKICA GSILQTKPLS TTFLPMLPSQ ASDFLQVAYL  240
NDEQGLNEVE KSCRVEAEDE DDMGGCELSL SISLPRPHPS SQR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-172070454Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-172070454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-172070454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-172070454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-172070454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-172070454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-172070454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-172070454Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0004ss00660.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150431e-112AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017427114.11e-169PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLA0A0S3T1781e-167A0A0S3T178_PHAAN; Uncharacterized protein
STRINGXP_007153120.11e-146(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55393353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.16e-30G2-like family protein