PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0004ss00310.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 326aa    MW: 36831.7 Da    PI: 7.6574
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0004ss00310.5genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like68.97.9e-22187231145
            G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtleh 45 
                        k+r++W+peLH+rFv+a+e+LGGs+ AtPk+i+elm v+gLt+++
  Vang0004ss00310.5 187 KQRRCWSPELHHRFVKALEELGGSQAATPKQIRELMRVDGLTNDE 231
                        79****************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.53E-9185238IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-18186239IPR009057Homeodomain-like
TIGRFAMsTIGR015576.4E-16187231IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MGCVYFLFIF QWTNISTVLA FMVAAISALK EELAKCRAFK AEPVLEEFIP LKREYEEKED  60
NEKEEECRNK NDWVSSFQLW NTEDEAYNRS KACRLEQKQK KSKGEERKSM EKDYFQHDSN  120
RNVERGFVMP LSTYLATEEE CVVDGLSLKT PATAVKNTRE GRGSRISSCR VVSSAPSPML  180
LPQSGRKQRR CWSPELHHRF VKALEELGGS QAATPKQIRE LMRVDGLTND EKYRLHTRRV  240
PAATAANCSI SGADLGGLWM HKESLKGTSY CSPQGPLQFA TQSGDTTSTT EGDNMIDDDV  300
MSRCFLTVNF ADKIRGVSHL LKNNT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0004ss00310.5
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017426146.10.0PREDICTED: myb family transcription factor EFM isoform X1
TrEMBLA0A0L9UUK30.0A0A0L9UUK3_PHAAN; Uncharacterized protein
STRINGGLYMA07G29490.11e-132(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.13e-31G2-like family protein