PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0004ss00310.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 332aa    MW: 37524.5 Da    PI: 7.9051
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0004ss00310.4genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.51.1e-31187242156
            G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                        k+r++W+peLH+rFv+a+e+LGGs+ AtPk+i+elm v+gLt+++vkSHLQkYRl+
  Vang0004ss00310.4 187 KQRRCWSPELHHRFVKALEELGGSQAATPKQIRELMRVDGLTNDEVKSHLQKYRLH 242
                        79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.068184244IPR017930Myb domain
SuperFamilySSF466891.29E-17185245IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.3E-29186245IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-25187242IPR006447Myb domain, plants
PfamPF002494.7E-8189240IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MGCVYFLFIF QWTNISTVLA FMVAAISALK EELAKCRAFK AEPVLEEFIP LKREYEEKED  60
NEKEEECRNK NDWVSSFQLW NTEDEAYNRS KACRLEQKQK KSKGEERKSM EKDYFQHDSN  120
RNVERGFVMP LSTYLATEEE CVVDGLSLKT PATAVKNTRE GRGSRISSCR VVSSAPSPML  180
LPQSGRKQRR CWSPELHHRF VKALEELGGS QAATPKQIRE LMRVDGLTND EVKSHLQKYR  240
LHTRRVPAAT AANCSISGAD LGGLWMHKES LKGTSYCSPQ GPLQFATQSG DTTSTTEGDN  300
MIDDDVMSRC FLTVNFADKI RGVSHLLKNN T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-14187240255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-14187240255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-14187240154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-14187240154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-14187240154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-14187240154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-14187240255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-14187240255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-14187240255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-14187240255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-14187240255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-14187240255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0004ss00310.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017426146.10.0PREDICTED: myb family transcription factor EFM isoform X1
TrEMBLA0A0L9UUK30.0A0A0L9UUK3_PHAAN; Uncharacterized protein
STRINGGLYMA07G29490.11e-139(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.16e-38G2-like family protein