PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0004ss00310.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 336aa    MW: 38028.4 Da    PI: 7.1067
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0004ss00310.2genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like68.98.3e-22196240145
            G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtleh 45 
                        k+r++W+peLH+rFv+a+e+LGGs+ AtPk+i+elm v+gLt+++
  Vang0004ss00310.2 196 KQRRCWSPELHHRFVKALEELGGSQAATPKQIRELMRVDGLTNDE 240
                        79****************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.88E-9194247IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-18195248IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-16196240IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MPATGCPCSR NFSPDWNLNW SRSKRSNASF LSASISALKE ELAKCRAFKA EPVLEEFIPL  60
KREYEEKEDN EKEEECRNKN DWVSSFQLWN TEDEAYNRSK ACRLEQKQKK SKGEERKSME  120
KDYFQHDSNR NVERGFVMPL STYLATEEEC VVDGLSLKTP ATAVKNTREG RGSRISSCRV  180
VSSAPSPMLL PQSGRKQRRC WSPELHHRFV KALEELGGSQ AATPKQIREL MRVDGLTNDE  240
KYRLHTRRVP AATAANCSIS GADLGGLWMH KESLKGTSYC SPQGPLQFAT QSGDTTSTTE  300
GDNMIDDDIK LEEFHIYSRT THDYIKEDGS SERGF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0004ss00310.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014519321.10.0transcription factor HHO2 isoform X1
TrEMBLA0A0S3T1Q60.0A0A0S3T1Q6_PHAAN; Uncharacterized protein
STRINGGLYMA07G29490.11e-131(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.19e-31G2-like family protein