PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0004ss00310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 342aa    MW: 38721.2 Da    PI: 7.4263
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0004ss00310.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.41.2e-31196251156
            G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                        k+r++W+peLH+rFv+a+e+LGGs+ AtPk+i+elm v+gLt+++vkSHLQkYRl+
  Vang0004ss00310.1 196 KQRRCWSPELHHRFVKALEELGGSQAATPKQIRELMRVDGLTNDEVKSHLQKYRLH 251
                        79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.068193253IPR017930Myb domain
SuperFamilySSF466891.35E-17194254IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.6E-29195254IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-25196251IPR006447Myb domain, plants
PfamPF002494.9E-8198249IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MPATGCPCSR NFSPDWNLNW SRSKRSNASF LSASISALKE ELAKCRAFKA EPVLEEFIPL  60
KREYEEKEDN EKEEECRNKN DWVSSFQLWN TEDEAYNRSK ACRLEQKQKK SKGEERKSME  120
KDYFQHDSNR NVERGFVMPL STYLATEEEC VVDGLSLKTP ATAVKNTREG RGSRISSCRV  180
VSSAPSPMLL PQSGRKQRRC WSPELHHRFV KALEELGGSQ AATPKQIREL MRVDGLTNDE  240
VKSHLQKYRL HTRRVPAATA ANCSISGADL GGLWMHKESL KGTSYCSPQG PLQFATQSGD  300
TTSTTEGDNM IDDDIKLEEF HIYSRTTHDY IKEDGSSERG F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-13196249154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-13196249154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-13196249154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-13196249154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0004ss00310.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014519321.10.0transcription factor HHO2 isoform X1
TrEMBLA0A0L9UUK30.0A0A0L9UUK3_PHAAN; Uncharacterized protein
STRINGGLYMA07G29490.11e-139(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-37G2-like family protein