PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0002ss01450.2
Common NameLR48_Vigan06g068800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 270aa    MW: 30339.1 Da    PI: 9.1959
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0002ss01450.2genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.56.4e-332175155
            G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                       kprlrWt +LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  Vang0002ss01450.2 21 KPRLRWTADLHDRFVDAVTKLGGPDKATPKSVLRLMGLKGLTLYHLKSHLQKYRL 75
                       79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.0E-321876IPR009057Homeodomain-like
PROSITE profilePS5129412.4551878IPR017930Myb domain
SuperFamilySSF466892.69E-162178IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-242176IPR006447Myb domain, plants
PfamPF002497.8E-92374IPR001005SANT/Myb domain
PfamPF143792.5E-23119165IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MEGGGRESYN GLVMTMTRDP KPRLRWTADL HDRFVDAVTK LGGPDKATPK SVLRLMGLKG  60
LTLYHLKSHL QKYRLGQQTR KQNEEMNKEN SRCSFVNFST RSSGPNTTYR GDNEGGETPI  120
AEALRHQIEV QKRLEEQLEV QKKLQMRIEA QGKYLQAVLE KAQRTLSLDG SGGLEASRAQ  180
LTEFNSALSN FMENMNKDSK ENIIEVTGFY NKNHGSAFHY EEVGREQNRD QKPKIDGGSI  240
QFDLNIKGSN DLMSSGGAEM DVNMISYRG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-192174255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-192174255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-192174255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-192174255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-192174255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-192174255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-192174255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-192174255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0002ss01450.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017426744.10.0PREDICTED: myb family transcription factor PHL11
SwissprotC0SVS44e-81PHLB_ARATH; Myb family transcription factor PHL11
TrEMBLA0A0L9US080.0A0A0L9US08_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T4090.0A0A0S3T409_PHAAN; Uncharacterized protein
STRINGXP_007158199.10.0(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.11e-82G2-like family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]
  2. Petridis A,Döll S,Nichelmann L,Bilger W,Mock HP
    Arabidopsis thaliana G2-LIKE FLAVONOID REGULATOR and BRASSINOSTEROID ENHANCED EXPRESSION1 are low-temperature regulators of flavonoid accumulation.
    New Phytol., 2016. 211(3): p. 912-25
    [PMID:27125220]