PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0002ss01450.1
Common NameLR48_Vigan06g068800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 283aa    MW: 31852.8 Da    PI: 8.4399
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0002ss01450.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like391.7e-122146126
            G2-like  1 kprlrWtpeLHerFveaveqLGGsek 26
                       kprlrWt +LH+rFv+av++LGG++k
  Vang0002ss01450.1 21 KPRLRWTADLHDRFVDAVTKLGGPDK 46
                       79**********************98 PP

2G2-like491.4e-1559882655
            G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55
                       +AtPk++l+lm++kgLtl+h+kSHLQkYRl
  Vang0002ss01450.1 59 EATPKSVLRLMGLKGLTLYHLKSHLQKYRL 88
                       7****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-291889IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-182189IPR006447Myb domain, plants
SuperFamilySSF466894.66E-132191IPR009057Homeodomain-like
PfamPF002491.4E-72387IPR001005SANT/Myb domain
PfamPF143792.7E-23132178IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MEGGGRESYN GLVMTMTRDP KPRLRWTADL HDRFVDAVTK LGGPDKNDIN LKCFVFCSEA  60
TPKSVLRLMG LKGLTLYHLK SHLQKYRLGQ QTRKQNEEMN KENSRCSFVN FSTRSSGPNT  120
TYRGDNEGGE TPIAEALRHQ IEVQKRLEEQ LEVQKKLQMR IEAQGKYLQA VLEKAQRTLS  180
LDGSGGLEAS RAQLTEFNSA LSNFMENMNK DSKENIIEVT GFYNKNHGSA FHYEEVGREQ  240
NRDQKPKIDG GSIQFDLNIK GSNDLMSSGG AEMDVNMISY RG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-152187154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-152187154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-152187154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-152187154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0002ss01450.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017426744.10.0PREDICTED: myb family transcription factor PHL11
SwissprotC0SVS47e-77PHLB_ARATH; Myb family transcription factor PHL11
TrEMBLA0A0L9US080.0A0A0L9US08_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T4090.0A0A0S3T409_PHAAN; Uncharacterized protein
STRINGXP_007158199.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51013142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.12e-78G2-like family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]
  2. Petridis A,Döll S,Nichelmann L,Bilger W,Mock HP
    Arabidopsis thaliana G2-LIKE FLAVONOID REGULATOR and BRASSINOSTEROID ENHANCED EXPRESSION1 are low-temperature regulators of flavonoid accumulation.
    New Phytol., 2016. 211(3): p. 912-25
    [PMID:27125220]