PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0002ss01390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family GRF
Protein Properties Length: 285aa    MW: 32195.4 Da    PI: 6.7065
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0002ss01390.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC42.51.1e-136892125
                WRC  1 daepgrCrRtDGKkWRCsrrvlegk 25
                       d+epgrCrRtDGKkWRCsr++ +++
  Vang0002ss01390.1 68 DPEPGRCRRTDGKKWRCSRDAHPDS 92
                       79********************997 PP

2QLQ58.12.7e-201449237
                QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                       +FTaaQ+++L++Q+l++KyL a++ vPp+Ll++i+k
  Vang0002ss01390.1 14 PFTAAQWHELEHQALIFKYLKAGLSVPPDLLLPIRK 49
                       9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.5E-121349IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.3E-151448IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.6931449IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166713.05668112IPR014977WRC domain
PfamPF088796.2E-106992IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MSVPPPSTAA MWTPFTAAQW HELEHQALIF KYLKAGLSVP PDLLLPIRKS LQFMAHPSLG  60
GYYGKKIDPE PGRCRRTDGK KWRCSRDAHP DSNATTATPT LPHLHMDPLT LSGDNTKKTY  120
RCCSLLLNIC EVLDFLVTMF WMFSEIMRWG FRFGLNSEAD EHVLQKDLGS VRYQGYDFTS  180
DSMWSHMSPI PSSTVSESRS GSTMLGNCFQ QQTMRDAELL NLETARTKDL IFSSQLSSAG  240
SLKQEYQSPQ SLFSDWDWKK DLSSSAIEYR PNKDFNCNPD ANVD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003612622.11e-102growth-regulating factor
TrEMBLA0A0B2PWE61e-139A0A0B2PWE6_GLYSO; Uncharacterized protein
STRINGGLYMA01G35145.16e-89(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF149481112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-29growth-regulating factor 5