PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678470291
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 249aa    MW: 27256.5 Da    PI: 6.5077
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678470291genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like110.11.1e-34188242155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                k+r+rWtpeLHe Fveav++LGGsekAtPk +l+lm+v+gLt++hvkSHLQkYR+
  678470291 188 KQRMRWTPELHETFVEAVNKLGGSEKATPKGVLKLMNVDGLTIYHVKSHLQKYRT 242
                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-32185243IPR009057Homeodomain-like
PROSITE profilePS5129413.742185245IPR017930Myb domain
SuperFamilySSF466898.78E-19187242IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-26188242IPR006447Myb domain, plants
PfamPF002493.3E-11190241IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
METKPVGHIF SSCAGFSTDL HTSSIRRPEK HLRKTPLISQ SKGVGESIAL AQCAHPSILQ  60
SKCGGEHDDS WSTDRFPDFP VSHSLQSNSP DAGCSDEMAV AFEDLSKSSE WQEWADQLIT  120
DDDALAADWS GLLVDVKAPS LEPPEEAPKQ QVKILIQQTR VSQQLPGTHG ETCSKNGQSS  180
SPAGASPKQR MRWTPELHET FVEAVNKLGG SEKATPKGVL KLMNVDGLTI YHVKSHLQKY  240
RTARIRSET
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012830829.15e-89PREDICTED: protein PHR1-LIKE 1-like isoform X1
TrEMBLA0A022S2545e-89A0A022S254_ERYGU; Uncharacterized protein
STRINGVIT_07s0005g04120.t012e-74(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27532349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.13e-48phosphate starvation response 1