PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678468388
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family CO-like
Protein Properties Length: 346aa    MW: 37605.6 Da    PI: 8.4848
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678468388genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box216.8e-073271440
   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg...Htvv 40
               + C+ ++  +++lfC ++  ++C +C +  H +   H++v
  678468388 32 KLCSCCDAAPAILFCVSDAAFFCVSCDSRLHVNkplHERV 71
               57*****************************878888865 PP

2zf-B_box28.33.8e-0970116242
   zf-B_box   2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                + ++C+ +e+ ++ l C+ ++  lC  C + +H+       H++v+l
  678468388  70 RVWICDVCERSPAVLACKADSAALCSACDSDIHSAnplasrHERVSL 116
                5689*****************************66899999999875 PP

3CCT69.11.1e-23255298144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                Rea++lRYkeKrk+RkFeK+irY+sRKa+Ae RpRvKGrF+k++
  678468388 255 REARVLRYKEKRKRRKFEKTIRYASRKAYAEARPRVKGRFAKRP 298
                9****************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501198.9162973IPR000315B-box-type zinc finger
SMARTSM003360.152967IPR000315B-box-type zinc finger
CDDcd000213.82E-53373No hitNo description
PROSITE profilePS5011910.18269116IPR000315B-box-type zinc finger
SMARTSM003361.6E-1369116IPR000315B-box-type zinc finger
PfamPF006432.7E-770116IPR000315B-box-type zinc finger
CDDcd000212.60E-872116No hitNo description
PROSITE profilePS5101716.569255297IPR010402CCT domain
PfamPF062031.1E-17255297IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MGIFSVDHGA AAAAAAAIRS RFFPGGHNPG RKLCSCCDAA PAILFCVSDA AFFCVSCDSR  60
LHVNKPLHER VWICDVCERS PAVLACKADS AALCSACDSD IHSANPLASR HERVSLSAFY  120
HTAEKMMGAF NAPPQPVELM LLDSDSPQNF LDLDYYSISS HPGVAPCRPI PEPPPATARL  180
LQDFSPENGI KLEFPPSHFN SYASSNNNPS LSYTVSSPSI DYGVVPDGSS MSELSHPFPR  240
SICIDVPKNQ GDVDREARVL RYKEKRKRRK FEKTIRYASR KAYAEARPRV KGRFAKRPPP  300
PTTRPSAASS SPNRIPDPDT ASFRRSSTDF GASDLGPVPG RPIVIS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1264269KRKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011069877.18e-81PREDICTED: zinc finger protein CONSTANS-LIKE 5-like
TrEMBLA0A022R0P73e-68A0A022R0P7_ERYGU; Uncharacterized protein
TrEMBLA0A0K2SFT43e-68A0A0K2SFT4_GENTR; Gentian CONSTANS-like5 homolog
STRINGPGSC0003DMT4000706809e-66(Solanum tuberosum)
STRINGfgenesh2_kg.8__1679__AT5G57660.14e-66(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.11e-32CONSTANS-like 3