PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678468330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family CO-like
Protein Properties Length: 315aa    MW: 35980.5 Da    PI: 8.3369
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678468330genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box28.82.5e-09952340
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
               +r+C+ + ++ +++fC  ++ +lC++C ++ H+       H++v
  678468330  9 KRVCDYCARNGARWFCAGDDAFLCQSCDFSVHSAntlarrHQRV 52
               689*****************************667888888876 PP

2CCT64.43.3e-22269312144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                R a+++RY++Kr+tR+F+K+irY++RK++A++RpR+KGrFvk++
  678468330 269 RGARVSRYRDKRRTRLFSKRIRYAVRKVNADNRPRMKGRFVKRE 312
                789**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.281754IPR000315B-box-type zinc finger
SMARTSM003366.6E-11754IPR000315B-box-type zinc finger
PfamPF006432.9E-7952IPR000315B-box-type zinc finger
CDDcd000212.99E-81054No hitNo description
PROSITE profilePS5101715.567269311IPR010402CCT domain
PfamPF062039.2E-17269311IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MVAIGRMAKR VCDYCARNGA RWFCAGDDAF LCQSCDFSVH SANTLARRHQ RVRLKSASGW  60
ETRVPVWHRN AARKARSPRQ KRGVSGIAAT WYPLHLVPES SSEDKSVDDE HGLYRVPTMH  120
PLVEQFSNSP NPSGEEETLF DEFMASDIDV AEFAADVESL LGNEKFEMEE IGIFECEMLS  180
HHQNAEEFKD HGTKMELTPS NTFLNLNFER VLREWDDEKS PWMTGKRPDF NSGDCWLLNC  240
TGSCGKTHTD GPIGMMTGHP AATRSDAERG ARVSRYRDKR RTRLFSKRIR YAVRKVNADN  300
RPRMKGRFVK RELAT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076793.14e-96PREDICTED: zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A068L8852e-79A0A068L885_9MYRT; Zinc finger protein CONSTANS-LIKE 5
STRINGVIT_01s0011g03520.t013e-74(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15392470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.13e-57B-box type zinc finger protein with CCT domain