PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678468174
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family CO-like
Protein Properties Length: 342aa    MW: 37287.4 Da    PI: 5.9637
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678468174genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.17.6e-081050337
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......H 37
               ++ C+ ++e +++ fC+ ++ +lC+ C +  H+       H
  678468174 10 AKLCNFCKEVPASVFCRADSAFLCAPCDDRVHSAnklasrH 50
               578**************************999655555556 PP

2zf-B_box28.14.2e-095498442
   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                +C+ +e+ ++ + C+ +   lC++C   +H+       H+++p+
  678468174 54 GICEVCEQAPAAFTCKADAAALCASCDRDIHSAnslasrHERIPV 98
               68*****************************66889999998875 PP

3CCT691.3e-23279322144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                Rea++lRY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k++
  678468174 279 REARVLRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRT 322
                9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.424855IPR000315B-box-type zinc finger
SMARTSM003368.5E-13855IPR000315B-box-type zinc finger
PfamPF006434.5E-61152IPR000315B-box-type zinc finger
CDDcd000213.31E-81253No hitNo description
PROSITE profilePS5011910.6515198IPR000315B-box-type zinc finger
PfamPF006433.2E-75498IPR000315B-box-type zinc finger
CDDcd000211.92E-75598No hitNo description
SMARTSM003361.4E-95698IPR000315B-box-type zinc finger
PfamPF062031.5E-17279321IPR010402CCT domain
PROSITE profilePS5101716.797279321IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MVGESRSRAA KLCNFCKEVP ASVFCRADSA FLCAPCDDRV HSANKLASRH ARVGICEVCE  60
QAPAAFTCKA DAAALCASCD RDIHSANSLA SRHERIPVIP FYDAASASKS TGPPAAGEFS  120
EEEAEAASWL LPDPDCKAAV EDLNSPGYTS AEYLFNEMDN HYLDLDLIPG DQKPGHHADG  180
VDEKQVYSDG VVPVQHKSDL NSSVQYPGPA VNGYPSYDVE YPSPKPLIYS FSSQAISHSV  240
SSSSIDVGVV PDQGDVSTTH WKNDVGSDGA PTPVSGVDRE ARVLRYREKR KNRRFEKTIR  300
YASRKAYAET RPRIKGRFAK RTELDVDWLV HQDPSYGVVP SS
Cis-element ? help Back to Top
SourceLink
PlantRegMap678468174
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011078988.11e-139zinc finger protein CONSTANS-LIKE 4-like
TrEMBLA0A2G9H9E31e-138A0A2G9H9E3_9LAMI; GATA-4/5/6 transcription factor
STRINGXP_009590370.11e-129(Nicotiana tomentosiformis)
STRINGXP_009618115.11e-129(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.18e-82CONSTANS-like 3