PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678468169
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 410aa    MW: 45459.4 Da    PI: 7.9185
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678468169genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.11.7e-40166243178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +CqvegC+ dl++ak+yhrrh++Ce hsk+p+v+v+g+e+rfCqqCsrfh+lsefD+ krsCrrrL++hn+rrr++q+
  678468169 166 CCQVEGCNLDLKSAKDYHRRHRICENHSKSPKVVVAGMERRFCQQCSRFHDLSEFDDMKRSCRRRLSDHNARRRRAQP 243
                6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.8E-34162228IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.402164241IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.71E-38165246IPR004333Transcription factor, SBP-box
PfamPF031104.8E-32167240IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
KDNLAEFLLR VLYADHVVPE LCLGQKGIAW NPHEKPDKHS IRDCPAPVHL VFSEGNTELK  60
PTEFQEQICF CFPMSSSGSR ALCGNDLGTC SSSKYPISCA AHESTVAHCR SAYEDLFSLH  120
NLGGTLASPP ACSTGLRLSR PRAKSSVSSS PMKRSRASYH NLQNPCCQVE GCNLDLKSAK  180
DYHRRHRICE NHSKSPKVVV AGMERRFCQQ CSRFHDLSEF DDMKRSCRRR LSDHNARRRR  240
AQPESFQLIS QGLPSAFYGH KIEHDLLFNG LPIPQTGAVD RTLCFSGDET LQSISGVHLD  300
STRNIMDQSS QMPNANSPII PDLLSTAPSL LSSSPWTLNE SETHHAQGLV PGNYIPTIRH  360
FDSESQPLPL FHPNHSPISV PIPLMNTIAT ADPPPAYRLF KSGNLFLGNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-281672401184squamosa promoter binding protein-like 4
Cis-element ? help Back to Top
SourceLink
PlantRegMap678468169
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093932.12e-72squamosa promoter-binding-like protein 12
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA136441216
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.31e-42squamosa promoter binding protein-like 2