PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678466617
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 115aa    MW: 13173.5 Da    PI: 7.3657
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678466617genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.92.1e-4137112277
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
        SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                Cqv++C+a+l++ak yhrrhkvCe+h+ka++vl++g +qrfCqqCsrfhelsefD++krsCrrrLa+hnerrrk++
  678466617  37 CQVDDCTANLTSAKLYHRRHKVCEFHAKAAAVLLQGSQQRFCQQCSRFHELSEFDDSKRSCRRRLAGHNERRRKST 112
                **************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.1E-343098IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.69334111IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.66E-3736114IPR004333Transcription factor, SBP-box
PfamPF031102.1E-3337110IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MERDKYCETG DEDEAAEDEE SSWVAASKPG SSQPRSCQVD DCTANLTSAK LYHRRHKVCE  60
FHAKAAAVLL QGSQQRFCQQ CSRFHELSEF DDSKRSCRRR LAGHNERRRK STCDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-3929110384squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678466617
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009622641.11e-42PREDICTED: squamosa promoter-binding protein 1
RefseqXP_011096328.19e-43squamosa promoter-binding protein 1
RefseqXP_016433751.11e-42PREDICTED: squamosa promoter-binding protein 1-like
SwissprotQ387416e-43SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A2G9GQ121e-43A0A2G9GQ12_9LAMI; Squamosa promoter-binding-like protein
STRINGXP_009622640.14e-42(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74924105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.21e-41squamosa promoter binding protein-like 4
Publications ? help Back to Top
  1. Klein J,Saedler H,Huijser P
    A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA.
    Mol. Gen. Genet., 1996. 250(1): p. 7-16
    [PMID:8569690]