PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678464331
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 382aa    MW: 42021.9 Da    PI: 7.5527
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678464331genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.56e-28107161156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k +++WtpeLH+rFv+ave+L G +kA+P++ilelm++++Lt+++v+SHLQkYR++
  678464331 107 KVKVDWTPELHRRFVQAVEKL-GVDKAVPSRILELMGIDCLTRHNVASHLQKYRSH 161
                5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.344104163IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.6E-27105164IPR009057Homeodomain-like
SuperFamilySSF466891.34E-18105164IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-27107161IPR006447Myb domain, plants
PfamPF002492.5E-8110159IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MEQDPSLQGT DFSDFSVENL LETLDFDDFF VGINDADLLS SPGMDPEIFH DFTVPDDEQS  60
ALPPKKMKDE KRASSDQVKK KPLGDKSTPK EKRSTAPSSK SLTGKKKVKV DWTPELHRRF  120
VQAVEKLGVD KAVPSRILEL MGIDCLTRHN VASHLQKYRS HRKHLLAREA EAANWNQRRQ  180
MYGAPAAAGS GSANKDHMST WIMPPTIGYP PVPSVPPYRP LHVWGHPSVD PSYMHMWQPN  240
HMPQSPAPSQ AWPAPSQPPS PQPSADPSLW IPLHNVPTPG TPCFSSHLPP PPAIAQRFPA  300
VSVPSVAPPQ PNIAVPAMHH SQRLPQPPSD IHPSTETVDA AIGDVLSKPW MPLPLGLKPP  360
SVDSVMVELQ RQGIPKIPPS FS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A9e-17103159157ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002275230.11e-119PREDICTED: transcription activator GLK1
SwissprotQ9SIV31e-79GLK1_ARATH; Transcription activator GLK1
TrEMBLA0A068V5131e-119A0A068V513_COFCA; Uncharacterized protein
STRINGVIT_12s0028g03100.t011e-118(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25322356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.11e-63GBF's pro-rich region-interacting factor 1