PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678464136
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family WRKY
Protein Properties Length: 461aa    MW: 50484.4 Da    PI: 7.4261
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678464136genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.25.3e-3175132260
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                dDgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers   ++++ei+Y+g+H+h+k
  678464136  75 DDGYNWRKYGQKLVKGSEFPRSYYKCTFPNCEVKKIFERSP-SGHITEIVYKGSHDHPK 132
                8****************************************.9**************85 PP

2WRKY1079.4e-34288346159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYGqK+v+g+++prsYY+Ct +gCpv+k+ver+++dpk+v++tYeg+Hnh+
  678464136 288 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNPGCPVRKHVERASHDPKAVITTYEGKHNHD 346
                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.0E-2665133IPR003657WRKY domain
PROSITE profilePS5081122.51569133IPR003657WRKY domain
SuperFamilySSF1182906.54E-2473133IPR003657WRKY domain
SMARTSM007741.5E-3274132IPR003657WRKY domain
PfamPF031064.8E-2375131IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.0E-38273348IPR003657WRKY domain
SuperFamilySSF1182901.22E-29280348IPR003657WRKY domain
PROSITE profilePS5081138.629283348IPR003657WRKY domain
SMARTSM007741.3E-39288347IPR003657WRKY domain
PfamPF031062.8E-26289346IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MPAGLSKTGS TSNQDQCCSH PPPSSPQAAL AVADAARFRT TATDEFSQEG TRSIQASSSD  60
QKDGISSASV DKASDDGYNW RKYGQKLVKG SEFPRSYYKC TFPNCEVKKI FERSPSGHIT  120
EIVYKGSHDH PKPQPVRRHN SIMALAAHED KMNKDLLLRG HEGTCHTCIS SHTTSQNMES  180
LELDSPYHIV EVLENVIAGS FILLFHVDKF SSSNLEQNGS PVVSPLSANE VGLDGAGPQV  240
PGNIEDVEEE GQCIKRRKLE DCMDVTPVVR PIREPRVVVQ TVSEVDILDD GYRWRKYGQK  300
VVRGNPNPRS YYKCTNPGCP VRKHVERASH DPKAVITTYE GKHNHDVPTA KSSSHDFPGT  360
GPPPHVRASK IRPQDGPLIS LDLGVGISRN RTNEPVPRTL ESESTRAVVH TAQDSACYGI  420
VTNSYGIREN PIEGHGFQTP AVLPSNPCPP IQSVGRIRMG P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-3864348777Probable WRKY transcription factor 4
2lex_A3e-3864348777Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095503.11e-174PREDICTED: probable WRKY transcription factor 20
TrEMBLA0A0D5Y9D01e-152A0A0D5Y9D0_SALMI; WRKY protein
STRINGPGSC0003DMT4000766701e-131(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40252344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.15e-96WRKY family protein