PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678463717
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family MIKC_MADS
Protein Properties Length: 194aa    MW: 22229.5 Da    PI: 9.2017
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678463717genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.66.8e-28959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krie+ks rqvtfskRr+g+lKKA ELSvLC+a++ v+i+s tgklyeyss
  678463717  9 KRIEDKSARQVTFSKRRKGLLKKARELSVLCGADIGVVIYSGTGKLYEYSS 59
               79***********************************************96 PP

2K-box32.14.8e-121201704797
      K-box  47 slkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                s  +L  Le+qLe++l +iR+ K++lll+ i+ lq+ ++ l+een  L++k
  678463717 120 SAVDLVLLENQLETALLQIRKAKTHLLLNTISSLQHEKDLLSEENSLLETK 170
                6789******************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.66161IPR002100Transcription factor, MADS-box
SMARTSM004323.3E-37160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-29282IPR002100Transcription factor, MADS-box
CDDcd002657.13E-35273No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-25323IPR002100Transcription factor, MADS-box
PfamPF003194.9E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-253859IPR002100Transcription factor, MADS-box
PROSITE profilePS512977.91884178IPR002487Transcription factor, K-box
PfamPF014863.2E-8107170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009910Biological Processnegative regulation of flower development
GO:0010048Biological Processvernalization response
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MGRRRLEMKR IEDKSARQVT FSKRRKGLLK KARELSVLCG ADIGVVIYSG TGKLYEYSST  60
NSLTRTIWRY YNYVESETSL ATGDPKEKAD YTKHSEYITK EELLQVVERE LGEPSNDQRS  120
AVDLVLLENQ LETALLQIRK AKTHLLLNTI SSLQHEKDLL SEENSLLETK KVGIRKMEVK  180
KVALDLNVVP DDQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-19184183MEF2C
5f28_B2e-19184183MEF2C
5f28_C2e-19184183MEF2C
5f28_D2e-19184183MEF2C
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap678463717
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071241.11e-64agamous-like MADS-box protein AGL27 isoform X4
TrEMBLA0A1S3YA761e-58A0A1S3YA76_TOBAC; agamous-like MADS-box protein AGL27
STRINGXP_009595701.11e-60(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65060.16e-42MIKC_MADS family protein