PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678462029
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family MIKC_MADS
Protein Properties Length: 303aa    MW: 34049.1 Da    PI: 9.7479
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678462029genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.83.4e-29110160151
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                krien + rqvtf+kRr+g+lKKA+ELSvLC+aev++i+fss+gklyey+s
  678462029 110 KRIENATSRQVTFCKRRTGLLKKAYELSVLCEAEVSLIVFSSKGKLYEYAS 160
                79***********************************************86 PP

2K-box47.86.1e-17185252977
      K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqi 77 
                 eeak++ + qe++kL+++i+ +q e+R+llG  ++s slkeL+++e ++ek++ kiRsk+  +  + i
  678462029 185 SEEAKTQFYLQEASKLRNQIRDIQFENRKLLGR-VGSRSLKELKSMEAKIEKAIAKIRSKRVSVEANLI 252
                7899********************999*****6.8*************************988766665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.057102162IPR002100Transcription factor, MADS-box
SMARTSM004324.4E-39102161IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.67E-32103176IPR002100Transcription factor, MADS-box
CDDcd002653.62E-42103179No hitNo description
PROSITE patternPS003500104158IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-31104124IPR002100Transcription factor, MADS-box
PfamPF003191.2E-24111158IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-31124139IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-31139160IPR002100Transcription factor, MADS-box
PfamPF014867.9E-12184247IPR002487Transcription factor, K-box
PROSITE profilePS512977.076190289IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MSCSLEKGDE WGAAFLVKFV AINEPSNRRV MDDSIISTHS RFSSRYCCIA LPSCLHDGAW  60
LRFFVLIILI ISSPVNVVLF VQLPSMAPRN QEAESSNCHR RNGRGKVEIK RIENATSRQV  120
TFCKRRTGLL KKAYELSVLC EAEVSLIVFS SKGKLYEYAS SSVRETIERY KKAASGSTSS  180
VVITSEEAKT QFYLQEASKL RNQIRDIQFE NRKLLGRVGS RSLKELKSME AKIEKAIAKI  240
RSKRVSVEAN LIAGAQHDLE GIRSFISMNN MEPNRDYSRH GQLPVQLLYD VPSLAYPGNA  300
DDG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A4e-19103170168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
1egw_B4e-19103170168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
1egw_C4e-19103170168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
1egw_D4e-19103170168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
3kov_A5e-19103170168Myocyte-specific enhancer factor 2A
3kov_B5e-19103170168Myocyte-specific enhancer factor 2A
3kov_I5e-19103170168Myocyte-specific enhancer factor 2A
3kov_J5e-19103170168Myocyte-specific enhancer factor 2A
3p57_A5e-19103170168Myocyte-specific enhancer factor 2A
3p57_B5e-19103170168Myocyte-specific enhancer factor 2A
3p57_C5e-19103170168Myocyte-specific enhancer factor 2A
3p57_D5e-19103170168Myocyte-specific enhancer factor 2A
3p57_I5e-19103170168Myocyte-specific enhancer factor 2A
3p57_J5e-19103170168Myocyte-specific enhancer factor 2A
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678462029
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011082936.12e-76floral homeotic protein AGAMOUS
SwissprotQ93XH44e-61MADS1_VITVI; Agamous-like MADS-box protein MADS1
TrEMBLA0A2G9HUZ98e-73A0A2G9HUZ9_9LAMI; MADS box transcription factor
STRINGXP_009762632.13e-62(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42830.16e-62MIKC_MADS family protein
Publications ? help Back to Top
  1. Boss PK,Vivier M,Matsumoto S,Dry IB,Thomas MR
    A cDNA from grapevine (Vitis vinifera L.), which shows homology to AGAMOUS and SHATTERPROOF, is not only expressed in flowers but also throughout berry development.
    Plant Mol. Biol., 2001. 45(5): p. 541-53
    [PMID:11414613]
  2. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  3. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  4. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]