PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678461225
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 315aa    MW: 34473.6 Da    PI: 7.1095
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678461225genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.71.1e-324599155
    G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
               kprlrWt +LHerFv+av+qLGG+ kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  678461225 45 KPRLRWTADLHERFVDAVTQLGGASKATPKAIMRAMGVKGLTLFHLKSHLQKYRL 99
               79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-3142100IPR009057Homeodomain-like
PROSITE profilePS5129410.01142102IPR017930Myb domain
TIGRFAMsTIGR015571.7E-2345100IPR006447Myb domain, plants
SuperFamilySSF466894.3E-1645101IPR009057Homeodomain-like
PfamPF002498.3E-84798IPR001005SANT/Myb domain
PfamPF143799.9E-16142187IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MFPRMIQSRE AILSQDSAIQ VSTGSGYGQR LPGDPCMVQL TSDPKPRLRW TADLHERFVD  60
AVTQLGGASK ATPKAIMRAM GVKGLTLFHL KSHLQKYRLG KQSGKELGEA SKDGTNFLLM  120
FFLPLSSLQL LEHSVHLCSG YEVKEALRAQ MEVQSKLHLQ VEAEKHLQIR QDAERRYLAM  180
LEQACKMLAD QIIGDAAASD DVAAFSDKGS KNPVHGGSVI PVPCYPSHPS EDLGVPEIPP  240
DLQRGHADYS TKRSLTSPAG LPQELPLNDV KRPLLNFDST SALFLWGESD VITADLPLMQ  300
PPSHGMMGNG VVKTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A8e-1945101258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B8e-1945101258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A7e-1945101157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-1945101157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-1945101157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-1945101157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A8e-1945101258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C8e-1945101258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D8e-1945101258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F8e-1945101258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H8e-1945101258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J8e-1945101258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678461225
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020554068.11e-120uncharacterized protein LOC105175200
SwissprotQ94A574e-58PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLA0A2G9GE841e-130A0A2G9GE84_9LAMI; Uncharacterized protein
STRINGMigut.M01478.1.p1e-111(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA97642027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.14e-59G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]