PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678460884
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 178aa    MW: 20536.3 Da    PI: 10.1628
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678460884genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.32.5e-52141391128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrF Ptdeel+v+yL++kv+g +++l  +i e+d+yk++Pw+Lp k+  +ekewyfFs+r++ky++g+r+nr++ +gyWkatg+dk++++ +g++v
  678460884  14 LPPGFRFFPTDEELLVQYLCRKVAGYQFSL-PIIGEIDLYKFNPWELPDKALFGEKEWYFFSPRERKYPNGSRPNRVAGAGYWKATGTDKTIMT-EGRKV 111
                79**************************99.88***************8777899***************************************.999** PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kk Lvfy g+ap+g+kt+W+mheyrl
  678460884 112 GIKKALVFYVGKAPNGSKTNWIMHEYRL 139
                **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.28E-678162IPR003441NAC domain
PROSITE profilePS5100560.05314162IPR003441NAC domain
PfamPF023658.4E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MVARDSDPRN QLHLPPGFRF FPTDEELLVQ YLCRKVAGYQ FSLPIIGEID LYKFNPWELP  60
DKALFGEKEW YFFSPRERKY PNGSRPNRVA GAGYWKATGT DKTIMTEGRK VGIKKALVFY  120
VGKAPNGSKT NWIMHEYRLS DSGKKNSSKR LDDWVLCRIY MKSTGGRKAV SHEFSHGX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-9611684171NO APICAL MERISTEM PROTEIN
1ut4_B5e-9611684171NO APICAL MERISTEM PROTEIN
1ut7_A5e-9611684171NO APICAL MERISTEM PROTEIN
1ut7_B5e-9611684171NO APICAL MERISTEM PROTEIN
3swm_A5e-9611687174NAC domain-containing protein 19
3swm_B5e-9611687174NAC domain-containing protein 19
3swm_C5e-9611687174NAC domain-containing protein 19
3swm_D5e-9611687174NAC domain-containing protein 19
3swp_A5e-9611687174NAC domain-containing protein 19
3swp_B5e-9611687174NAC domain-containing protein 19
3swp_C5e-9611687174NAC domain-containing protein 19
3swp_D5e-9611687174NAC domain-containing protein 19
4dul_A5e-9611684171NAC domain-containing protein 19
4dul_B5e-9611684171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678460884
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419, ECO:0000269|PubMed:30610166}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019264575.11e-100PREDICTED: NAC domain-containing protein 72-like
SwissprotA0A3Q7HH641e-97JA2L_SOLLC; NAC domain-containing protein JA2L
TrEMBLA0A385ZAB89e-99A0A385ZAB8_VACCO; NAC072
STRINGcassava4.1_010991m2e-98(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31222452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.23e-98NAC family protein
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Du M, et al.
    MYC2 Orchestrates a Hierarchical Transcriptional Cascade That Regulates Jasmonate-Mediated Plant Immunity in Tomato.
    Plant Cell, 2017. 29(8): p. 1883-1906
    [PMID:28733419]
  3. Liu Y, et al.
    MYC2 Regulates the Termination of Jasmonate Signaling via an Autoregulatory Negative Feedback Loop.
    Plant Cell, 2019. 31(1): p. 106-127
    [PMID:30610166]