PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678460575
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 274aa    MW: 30018.2 Da    PI: 6.8413
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678460575genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like76.14.7e-2486140156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                kpr+ W  +LHe F++av+++ G e+A Pk+il  m+v+gLt+ehv+SHLQkYR +
  678460575  86 KPRISWDAKLHEIFLNAVNKI-GLENASPKKILVEMNVPGLTREHVASHLQKYRKH 140
                79*******************.9*******************************76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-2483141IPR009057Homeodomain-like
SuperFamilySSF466891.88E-1683141IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2286140IPR006447Myb domain, plants
PfamPF002497.2E-790138IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MALNRDFYVN AVVSVSKGTR KVACICLPDG MNLYCMLKVV SLVVKMYSGG GGVAEQAVPI  60
PMQTDGTPPS SRGGAHNMHV GETSKKPRIS WDAKLHEIFL NAVNKIGLEN ASPKKILVEM  120
NVPGLTREHV ASHLQKYRKH MTAKRVQKKR VLGGNGSTFI EQQPNSSAPP PCSQPEPCVI  180
TTPAVQQHAA PPVAQNPIMD FTCLHEEQHS QSTANTFEAT HQDQNLYTLE YIDTLMNESG  240
GPLLTESEAI PLPRSNSLED DYACLSPLWE NIDF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-1585138457ARR10-B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1975523
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.22e-19response regulator 1