PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678460227
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family CO-like
Protein Properties Length: 288aa    MW: 32787.2 Da    PI: 8.657
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678460227genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box292.2e-09748439
   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
               r C+++ e +++++Ce +  +lC+ C ++ H+       H++
  678460227  7 RACDNCMEYKASWYCEADAAFLCKICDSSVHSAnpvarrHNR 48
               57******99*********************65777777876 PP

2CCT72.78.6e-25236279144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                Rea+++RY+eKr+tR+F+K+irYe+RK +A++RpR+KGrFvk++
  678460227 236 REARVSRYREKRQTRLFSKTIRYEVRKLNAQNRPRIKGRFVKSS 279
                9****************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.381451IPR000315B-box-type zinc finger
SMARTSM003361.1E-10451IPR000315B-box-type zinc finger
CDDcd000211.67E-11744No hitNo description
PfamPF006438.9E-8749IPR000315B-box-type zinc finger
PfamPF062032.1E-19236278IPR010402CCT domain
PROSITE profilePS5101715.676236278IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MENAVSRACD NCMEYKASWY CEADAAFLCK ICDSSVHSAN PVARRHNRIR LKTAGVDPPV  60
PSWQHGFKRK TRTPRQAKNR GNGKTVDLVP EFELAKEENE EQILYRVPEF DPILAMFGKD  120
MNFEELLRCE VDASEFAADL QRLLEGSEGF GFLDVKNGDE LKTCEKMKVE EERISGYKSF  180
LKLDHAGVIL AWNGKKSPWI TGERPEPSTV SDFLGANERN SMDNVGELAS PADGSREARV  240
SRYREKRQTR LFSKTIRYEV RKLNAQNRPR IKGRFVKSSL FAAAREVV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076793.11e-69PREDICTED: zinc finger protein CONSTANS-LIKE 16
TrEMBLS8EME75e-70S8EME7_9LAMI; Uncharacterized protein
STRINGVIT_01s0011g03520.t019e-63(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15392470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49130.14e-41B-box type zinc finger protein with CCT domain