PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678459232
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family CPP
Protein Properties Length: 816aa    MW: 89867.5 Da    PI: 6.2776
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678459232genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.42.1e-16549586340
        TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                +k+CnCkkskClk+YCeCfaag++C e C C dC+Nk 
  678459232 549 CKRCNCKKSKCLKLYCECFAAGVYCVELCACVDCFNKP 586
                79**********************************96 PP

2TCR51.22.5e-16633671139
        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                ++k+gCnCkks ClkkYCeC++ g+ Cs +C+Ce+CkN 
  678459232 633 RHKRGCNCKKSGCLKKYCECYQGGVGCSVNCRCEGCKNA 671
                589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.3E-16547588IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.11548673IPR005172CRC domain
PfamPF036386.4E-12550585IPR005172CRC domain
SMARTSM011147.6E-18633674IPR033467Tesmin/TSO1-like CXC domain
PfamPF036387.5E-12635671IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 816 aa     Download sequence    Send to blast
MTRQKCWRLR IVEATTISLR PSAKLRFDLV SSQNVHPRYM GFLRISYSLF LGGDEWPADC  60
WYCTFLCFLK FGLMGSSFFF LLNCPGFLIR CGELISSRKL GFNLTLIMVN FDFCCLWKIE  120
SWMPKDSPVF NFLNSLSPIK PVKSIRISQT INPLNLASLP SIFTSPHVNS PRDYKILRRH  180
QLPDPSKPEF ASDHGNKAGE RSVNDDGIKQ MDAQEENPKV TETHGDLAGE TSFDGLQFVV  240
DYSEDPSDNS TSPRPISVLE AVREADIASS STKLISCDTS SPPSVPYASD VVLEGENLIN  300
QNSQVLNCEW DRLLSDSLIF ESPNDRDSYT KSMDPGSSLY IKVEDEINNI QSLCSADSTE  360
QLGEDSEPGP GNEIAEAYID PGEKLDYEVF GLYRGMRRRC LVFEMGGGRK KQLEESLGSE  420
SSSMLHPEGN DFYMDQNPVP TKRESISACR ALPGIGLHLN SLAATSKDYR IISHDSSASG  480
RLLIGPGPSV NFHSSVSNEV HCAVETENAM IPLDDGFQAS EYMETDDTNQ TSPKKKRRRA  540
EASGDVDGCK RCNCKKSKCL KLYCECFAAG VYCVELCACV DCFNKPVHED TVLATRKQIE  600
SRNPLAFAPK VIRGSDQLSE AGDDSSKTPA SARHKRGCNC KKSGCLKKYC ECYQGGVGCS  660
VNCRCEGCKN AFGRKDGMEA DIEDDESMDA TEKLVEKDLD SAAAAAAVPA TPLQGTATRQ  720
ALQQHHLSSK KKPPRGAAAS LSVLGKRSLH PPAKLAQHLE TVKENEMPDV LEESSSPSCV  780
VKSSSPNGKR VSPPHRSSRK LILRSIPSFP SLTQNQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A4e-1955067012120Protein lin-54 homolog
5fd3_B4e-1955067012120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1533538KKKRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap678459232
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090684.10.0LOW QUALITY PROTEIN: protein tesmin/TSO1-like CXC 2
TrEMBLA0A2G9GVD90.0A0A2G9GVD9_9LAMI; Metallothionein-like protein
STRINGMigut.G00370.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24672345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.11e-130Tesmin/TSO1-like CXC domain-containing protein