PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678459090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family Whirly
Protein Properties Length: 268aa    MW: 29374.4 Da    PI: 9.8676
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678459090genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly210.32e-65902271138
     Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlp 100
                svyk+kaal+v+++ p+f+ l sg++k++++G++ll++a+ +++r+ydW++kq+f+ls+te++++++l++++sceffhdp++++s+eG+vrk+lkvePlp
  678459090  90 SVYKGKAALTVEPRPPEFSPLGSGAFKISKEGFILLQFAPGVGTRQYDWSRKQVFSLSVTEIGTIISLGARDSCEFFHDPFKGKSDEGRVRKVLKVEPLP 189
                79************************************************************************************************** PP

     Whirly 101 dGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsll 138
                dGsG+f+nlsv+n++++++es+++P++kae avl s +
  678459090 190 DGSGHFFNLSVQNKITNVDESIYIPITKAELAVLVSSF 227
                **********************************9877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.107.7E-7879251IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544476.75E-7383268IPR009044ssDNA-binding transcriptional regulator
PfamPF085361.1E-6091224IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0032211Biological Processnegative regulation of telomere maintenance via telomerase
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003697Molecular Functionsingle-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0042162Molecular Functiontelomeric DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MLSPALSANP GVKPWFLKSG LSSNTLAAPC VTVFPRRREG EASSITLHGK RQLGVKAQYL  60
TPKEQNQGFS TYDSSVPGGQ LPPRVYVGYS VYKGKAALTV EPRPPEFSPL GSGAFKISKE  120
GFILLQFAPG VGTRQYDWSR KQVFSLSVTE IGTIISLGAR DSCEFFHDPF KGKSDEGRVR  180
KVLKVEPLPD GSGHFFNLSV QNKITNVDES IYIPITKAEL AVLVSSFNFI VPYLLGWNTF  240
ANSVKPEDSN RAAAGATSRY ASEFEWNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A1e-1057926732219p24: plant transcriptional regulator PBF-2
1l3a_B1e-1057926732219p24: plant transcriptional regulator PBF-2
1l3a_C1e-1057926732219p24: plant transcriptional regulator PBF-2
1l3a_D1e-1057926732219p24: plant transcriptional regulator PBF-2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011087065.11e-128PREDICTED: LOW QUALITY PROTEIN: single-stranded DNA-binding protein WHY1, chloroplastic, partial
SwissprotQ9M9S31e-108WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLA0A022QN471e-121A0A022QN47_ERYGU; Uncharacterized protein
STRINGGLYMA08G40850.11e-110(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA77312430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14410.11e-109ssDNA-binding transcriptional regulator