PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678458974
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 367aa    MW: 41708.8 Da    PI: 8.1508
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678458974genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.51.3e-323286155
    G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
               kprl+Wtp+LH+rF eav+qLGG+ekAtPk++l+lm+++gLtl+h+kSHLQkYRl
  678458974 32 KPRLKWTPDLHQRFTEAVNQLGGAEKATPKSVLKLMGIQGLTLYHLKSHLQKYRL 86
               79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.6462989IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-313088IPR009057Homeodomain-like
SuperFamilySSF466892.69E-163188IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-233287IPR006447Myb domain, plants
PfamPF002491.8E-93485IPR001005SANT/Myb domain
PfamPF143791.3E-18125170IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MFHHHQQGRN GYHSSEKHRP RDARLVLSTD AKPRLKWTPD LHQRFTEAVN QLGGAEKATP  60
KSVLKLMGIQ GLTLYHLKSH LQKYRLSKSH QGNSTAAKPA WRQAEVLGTQ TGIPRIATQQ  120
TRNVRIEEAN QMEIEVQQQL HEELEIQRHL QLRIEAQGKY LHSVLEKAHD TLWRQNMGAI  180
DVEAAKAQLS ELVSNVSSQS LNSIKEIQDF FQRQNKMAAA RKDSSTESCL TMPSIRDQEL  240
LLHAPSYFEE KTAQITENKT SQRSIELRRH ECGKESKDYI SSGNLYMGVD FSNDNNLLNM  300
FMSNGLSGGN QGSRRNRIEV FKGSEVEAEK QVTYSDMKLA LFSRALDLNA EGENEGDLSC  360
RELDLNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-203188158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-203188158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-203288157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-203288157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-203288157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-203288157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-203188158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-203188158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-203188158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-203188158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-203188158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-203188158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678458974
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022882948.11e-101myb-related protein 2-like isoform X1
SwissprotQ9SQQ92e-75PHL9_ARATH; Myb-related protein 2
TrEMBLA0A4D8ZZ203e-98A0A4D8ZZ20_SALSN; Uncharacterized protein
STRINGXP_009758035.14e-95(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29462451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-68G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nakano Y,Naito Y,Nakano T,Ohtsuki N,Suzuki K
    NSR1/MYR2 is a negative regulator of ASN1 expression and its possible involvement in regulation of nitrogen reutilization in Arabidopsis.
    Plant Sci., 2017. 263: p. 219-225
    [PMID:28818378]