PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678456702
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family CO-like
Protein Properties Length: 370aa    MW: 40342.6 Da    PI: 4.9544
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678456702genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.52.4e-072668440
   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                +C +++++++ l C+d ++ lC++C    H g      H+++
  678456702 26 LICGRCSSQPAFLRCFDESMSLCQNCDWLVHAGsgktssHKRE 68
               68*************************9999878888888876 PP

2CCT63.75.7e-22313356144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                R  a++RYkeK+k RkFeKk+rY+sRKa+A+ R RvKGrFvk+ 
  678456702 313 RTDAVMRYKEKKKARKFEKKVRYASRKAMADVRRRVKGRFVKAG 356
                889**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000211.34E-52770No hitNo description
PROSITE profilePS5101715.348313355IPR010402CCT domain
PfamPF062035.9E-17313355IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005886Cellular Componentplasma membrane
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MASLCLSCDH NVHSANALSK RHSRTLICGR CSSQPAFLRC FDESMSLCQN CDWLVHAGSG  60
KTSSHKREAI RCYSGCPSVS EPSAMVSFLV DLRSVGDSVC ENGMGSTSNG DKPSDLQESQ  120
GNDKPENASN FVEPGTSLND MDSASFWLDN VDNLASYSSI TPKAFTSGEK ELSGFCDDFN  180
MDEVDASIEN YDAFLDTALN NPEEFFNDDD IDGLFGPKYM SGFNCQDVTP AAEVSSEGGM  240
RLRPECSTAA SADSIISCKT EPNLFLGRQH SSISFSGITG GDHHDCGVSS MPAVGAPQWL  300
PPTHENSMPS SSRTDAVMRY KEKKKARKFE KKVRYASRKA MADVRRRVKG RFVKAGDAYD  360
FDPLEETRSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011100551.11e-137PREDICTED: zinc finger protein CONSTANS-LIKE 9
RefseqXP_011100552.11e-137PREDICTED: zinc finger protein CONSTANS-LIKE 9
RefseqXP_011100553.11e-137PREDICTED: zinc finger protein CONSTANS-LIKE 9
SwissprotQ9LUA92e-95COL10_ARATH; Zinc finger protein CONSTANS-LIKE 10
TrEMBLA0A068LFB81e-142A0A068LFB8_TECGR; CONSTANS-like protein 9
STRINGGLYMA13G11592.11e-121(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12702468
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48250.16e-87B-box type zinc finger protein with CCT domain