PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678456039
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family MIKC_MADS
Protein Properties Length: 146aa    MW: 16742.9 Da    PI: 6.1317
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678456039genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.14.1e-27352251
               ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               rien + rqvtfskRr g+ KKA+ELSvL+da++a+i+fss+g+ly yss
  678456039  3 RIENPTSRQVTFSKRRSGLVKKAYELSVLTDAQIALIVFSSKGRLYQYSS 52
               8***********************************************96 PP

2K-box47.48e-17801361570
      K-box  15 eslqqelakLkkeienLqreqR.hllGedLesLslkeLqqLeqqLekslkkiRskKn 70 
                    +e a L k+ie L  + R +l+GedL+++++++L+ LeqqL++sl+k Rs+K+
  678456039  80 HGAAHETADLSKKIELLDDSARqKLMGEDLDDCTIEDLEALEQQLHQSLSKFRSRKH 136
                5567899***********555527********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd002654.01E-35168No hitNo description
SMARTSM004321.8E-29153IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-27169IPR002100Transcription factor, MADS-box
PROSITE profilePS5006627.389154IPR002100Transcription factor, MADS-box
PfamPF003192.3E-25350IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-161631IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-163152IPR002100Transcription factor, MADS-box
PROSITE profilePS512978.99679146IPR002487Transcription factor, K-box
PfamPF014863.3E-1482136IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MRRIENPTSR QVTFSKRRSG LVKKAYELSV LTDAQIALIV FSSKGRLYQY SSPSTIEETL  60
ERYKKIEEIW ECTVTEGSTH GAAHETADLS KKIELLDDSA RQKLMGEDLD DCTIEDLEAL  120
EQQLHQSLSK FRSRKHLDEL KEKVPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1c7u_A2e-16368973MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM
1c7u_B2e-16368973MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that promotes flowering, especially in response to vernalization by short periods of cold, in an FLC-inpedendent manner. {ECO:0000269|PubMed:16778081}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678456039
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Maintained at very low levels by the polycomb-group (PcG) proteins MSI1, CLF, and EMF2 via histone methylation (H3K27me3). Derepressed upon cold treatment (vernalization). {ECO:0000269|PubMed:16778081}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011081162.11e-45MADS-box protein SOC1
SwissprotO827432e-41AGL19_ARATH; Agamous-like MADS-box protein AGL19
TrEMBLD1MDP76e-42D1MDP7_VITVI; Suppressor of overexpression of CO 1
STRINGAES800251e-42(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22950.19e-44AGAMOUS-like 19
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Suter L,Rüegg M,Zemp N,Hennig L,Widmer A
    Gene regulatory variation mediates flowering responses to vernalization along an altitudinal gradient in Arabidopsis.
    Plant Physiol., 2014. 166(4): p. 1928-42
    [PMID:25339407]