PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678456026
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 321aa    MW: 36268.5 Da    PI: 6.2514
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678456026genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.52.1e-56471731129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrFhPtdeel+++yL++k+ ++k++  +vi +vd+++vePwdLp k+k +ekewyfF+ +d+ky+tg+r+nrat++gyWkatgkdke+++ +++lv
  678456026  47 LPPGFRFHPTDEELITHYLRPKTVDSKFSS-RVIGDVDLNRVEPWDLPWKAKMGEKEWYFFCIKDRKYPTGSRTNRATQAGYWKATGKDKEIFR-GKALV 144
                79*************************999.99***************888999****************************************.99*** PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrle 129
                g+kktLvfykgrap+gekt+Wvmheyrle
  678456026 145 GMKKTLVFYKGRAPRGEKTNWVMHEYRLE 173
                ***************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.37E-6444196IPR003441NAC domain
PROSITE profilePS5100559.47747196IPR003441NAC domain
PfamPF023652.2E-2948172IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MMQDGAVESD CDRWRNHLMF DIIEVPLSCV GGSEMAGEGD GDRELVLPPG FRFHPTDEEL  60
ITHYLRPKTV DSKFSSRVIG DVDLNRVEPW DLPWKAKMGE KEWYFFCIKD RKYPTGSRTN  120
RATQAGYWKA TGKDKEIFRG KALVGMKKTL VFYKGRAPRG EKTNWVMHEY RLESKDSLHT  180
LSANKGEWVI NRVFKKSSNG KKVHISGLYE SPSSCSSAQP PLTELPSGSA AAVAEVTSGT  240
SNSQEERETT GELSPFEGNS SYRDSVFPRD QSFLNLLVEN YGAYARQHGG GYEFFPESDL  300
SATFAYAFLP QEHPYDHPLD Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-55322021171NO APICAL MERISTEM PROTEIN
1ut4_B8e-55322021171NO APICAL MERISTEM PROTEIN
1ut7_A8e-55322021171NO APICAL MERISTEM PROTEIN
1ut7_B8e-55322021171NO APICAL MERISTEM PROTEIN
4dul_A8e-55322021171NAC domain-containing protein 19
4dul_B8e-55322021171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009592902.11e-103PREDICTED: NAC domain-containing protein 100-like
RefseqXP_016490965.11e-103PREDICTED: NAC domain-containing protein 92-like
SwissprotQ9FLJ23e-91NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A068U1T74e-99A0A068U1T7_COFCA; Uncharacterized protein
STRINGSolyc02g088180.2.18e-98(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.12e-92NAC domain containing protein 100