PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678455583
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family WRKY
Protein Properties Length: 642aa    MW: 70213.2 Da    PI: 6.2248
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678455583genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.22.9e-32270327260
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                dDgy+WrKYGqK+vkgse+prsYY+Ctsa+Cpvkkkvers+ +++++ei+Y+g Hnh+k
  678455583 270 DDGYSWRKYGQKQVKGSEYPRSYYKCTSANCPVKKKVERSH-EGHITEIIYTGAHNHSK 327
                8****************************************.***************85 PP

2WRKY104.84.7e-33459517159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYGqK+vkg+++prsYY+Cts+gC+v+k+ver+++d k v++tYeg+Hnh+
  678455583 459 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSPGCNVRKHVERASHDLKSVITTYEGKHNHD 517
                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-28263327IPR003657WRKY domain
PROSITE profilePS5081123.365264328IPR003657WRKY domain
SuperFamilySSF1182904.58E-25267327IPR003657WRKY domain
SMARTSM007748.4E-36269327IPR003657WRKY domain
PfamPF031067.9E-25270325IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.6E-37444519IPR003657WRKY domain
SuperFamilySSF1182901.11E-28451519IPR003657WRKY domain
PROSITE profilePS5081138.538454519IPR003657WRKY domain
SMARTSM007742.6E-38459518IPR003657WRKY domain
PfamPF031064.5E-25460517IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 642 aa     Download sequence    Send to blast
MFSSPIPRSF FSPMMNDDMV VGSLGESLLG NRDHPLFPAS ELGEIASGVT GEKEATTADI  60
KGDGNESYTH LESKVGSGGN LVERMTARSG YKAPRLNAES IRSPDIPVNS DGQQPFLMTI  120
PPGLSPTALL DSPVFLNNSQ IMPSPTTGKL SFAPCGNSEI SASTTDRLQE LSFQDSLPFM  180
FNPITEPRSY GLQFLPGAVS LRADDSNFQQ NLVPVNFQSY ANSPGKEFSV SCTQDTICHS  240
VSVTESSQVF DDPSENTDQS SGDSTGSPAD DGYSWRKYGQ KQVKGSEYPR SYYKCTSANC  300
PVKKKVERSH EGHITEIIYT GAHNHSKSSS DARGLISSSA HGDMHHLQSD SQGEGVNNSD  360
HVWLSVKQQW SKENHEAASS VRMSQEYSNG GGVDGSSNFS NDEDGEHHAH DSIACDDEED  420
ESDSKRRRHE THTPEMHGAS RAVREPRVVV QTTSEVDILD DGYRWRKYGQ KVVKGNPNPR  480
SYYKCTSPGC NVRKHVERAS HDLKSVITTY EGKHNHDVPV AKNSSHVNSG NSNPHLSQQP  540
PPMLAPGHIH RSEPPQMLSN MTHFVRPELG GSVYGFGMNQ PSIPNLGFMP NHGRLPVLPL  600
HQYSGHQSQP VTLMMPKLEP LTTDSSGLGS CDGSSLYQQY MR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-37270520878Probable WRKY transcription factor 4
2lex_A2e-37270520878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097673.10.0PREDICTED: probable WRKY transcription factor 2 isoform X2
TrEMBLA0A0D5YAF41e-180A0A0D5YAF4_SALMI; WRKY protein
STRINGPOPTR_0011s17230.11e-170(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37112341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-125WRKY DNA-binding protein 2