PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678455438
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family CO-like
Protein Properties Length: 381aa    MW: 42356 Da    PI: 5.8681
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678455438genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.93.1e-06444539
   zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                C+ ++e++   +C+++   lC +C  + H+       H++
  678455438  4 LCDFCNEQRSLVYCRSDAARLCLSCDRYVHSAnglsmrHSR 44
               7*****************************65677777765 PP

2zf-B_box16.71.6e-054689441
   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                 C++++ +++   C +++  lC++C   +H++      H++++
  678455438 46 LLCEQCQCQPAVVRCIEDKLSLCQNCNWDIHSStnlaveHRLQT 89
               57*****************************8789999998876 PP

3CCT60.17.5e-21324367144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                R+ allRYk+K+k RkF+KkirY+sRK++A+ R+R KGrFvk+ 
  678455438 324 RDDALLRYKQKKKLRKFDKKIRYASRKVRADIRKREKGRFVKSG 367
                899**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.542147IPR000315B-box-type zinc finger
SMARTSM003367.3E-8147IPR000315B-box-type zinc finger
CDDcd000213.75E-5447No hitNo description
PROSITE profilePS501199.0864390IPR000315B-box-type zinc finger
CDDcd000210.002354777No hitNo description
SMARTSM0033624890IPR000315B-box-type zinc finger
PfamPF062031.9E-15324366IPR010402CCT domain
PROSITE profilePS5101714.475324366IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MGKLCDFCNE QRSLVYCRSD AARLCLSCDR YVHSANGLSM RHSRTLLCEQ CQCQPAVVRC  60
IEDKLSLCQN CNWDIHSSTN LAVEHRLQTI NCYSGCPSSS EFSNIWSFFS VDQDHSKLDH  120
DRELANVEKE DGNPAQHSKS DDYNMENAAM DAVDSDTGQR CASKRSSSLK ACSSNTKHSG  180
PVCDSLYDIP DVNLSLDLDH YGGFLDDTLP YSESGDLGSL LEIGSFDCIE GLEKASPMND  240
SSSNNETMFW TCNNTVSTDS ISCCKSDSKS PFATPSHSAI SHTFSGPAPS PELSIADYHE  300
KGLLHMDITE GIPPAHPTSS SACRDDALLR YKQKKKLRKF DKKIRYASRK VRADIRKREK  360
GRFVKSGDPY DYDPLDLIGN Q
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095879.11e-108PREDICTED: zinc finger protein CONSTANS-LIKE 10-like
RefseqXP_011095881.11e-108PREDICTED: zinc finger protein CONSTANS-LIKE 10-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12702468
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.44e-63CONSTANS-like 9