PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678455156
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 1005aa    MW: 111987 Da    PI: 6.1977
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678455156genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.62.4e-40150227178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +Cqv +C+adls+ak+yhrrhkvCevhska+ +lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  678455156 150 ICQVVDCKADLSNAKDYHRRHKVCEVHSKASRALVGNIMQRFCQQCSRFHILEEFDEGKRSCRRRLAGHNKRRRKAHP 227
                5**************************************************************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.3E-31144212IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.735148225IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.97E-37150228IPR004333Transcription factor, SBP-box
PfamPF031105.0E-29151224IPR004333Transcription factor, SBP-box
SuperFamilySSF484031.13E-10739889IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.1E-8739890IPR020683Ankyrin repeat-containing domain
CDDcd002048.16E-9781889No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1005 aa     Download sequence    Send to blast
MEAKVGGKLH RFCEPSVSDL NGLGKRSIEW DLNDWRWDGD FLRVSPLNPV PSDCRSGHPV  60
APQGPVKNGS LNFLASLSEK ALLENEMEKR DSEKRRRYIE VNQEHENDEA GSLDLVLGGQ  120
VFPVVDKETD KWEKSGKKFK LCGEQSTRTI CQVVDCKADL SNAKDYHRRH KVCEVHSKAS  180
RALVGNIMQR FCQQCSRFHI LEEFDEGKRS CRRRLAGHNK RRRKAHPENA AGSTSLNDDQ  240
GTKYLLISLL RILSNIQFNF NSPYFVITAG SSDQTRDQDL LSHLLKNLAA VSGSSNISNP  300
RGLLSVSPDF QNAGTSCGTT IRGNGSPDEI ALPLPHTSLT CKDALTDNAQ VGPARETSPL  360
RYATPSAKTS ACAERLKMNN IDLNSVYDDS EDHTEDLMYN VPLENPSPCV SPWSFKDSQR  420
SSPPQSQSPS TSSGEAQSRT DRIVFKLFGK DPNDFPHELR KQMIDWLSSS PTDIEGYIRP  480
GCIILTIYAC MDKSSWDELQ CNLNSSLKRL LDASSDPFWT TDWIYTRVQH RASFVYNGEV  540
VLDIPTLLGR AREGCWISMI SPIAVSFSET VHFSVKGYNL SGSTSSYWIY LVLEVCYNCI  600
RLLCALEGSY IFQESCADVV GADSFADNGE IQFLQFSCAV PNVVGRGFVE VEDYCLNSSF  660
FPFIVAEKDV CEAICDLEKV VDVSDSENLD ADKTEARNQA LNFVHEMGWL LHKHSLILSL  720
GETRDDVDLF SFRRFKCLIE YAIDHGWPAV ARKLLNVLFD GTVGTGKDTS AVTSLLDLGL  780
LHRAIRRNSI PMVKFLLEYQ PSGASSRSAD AHKETDCRSF LFRPDSTGPG GLTPLHIAAG  840
LDDAEDLVDA LTEDPESVGM GAWKSIRDYT GLTPHDYACL RGHYSYIYLV QRKQLSKSHG  900
QVVIDVPVTQ LDAAISKQKM ADVSSKMAVF HTEKTAGEMM SCRKCEQMLL YGSPKPSVAL  960
YRPAMLSMVL IAAVCVCAAL LFKSSPEVVY LFRPFRWELL KYGAE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-301502241084squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19297EKRRRY
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap678455156
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020547976.10.0LOW QUALITY PROTEIN: squamosa promoter-binding-like protein 1
TrEMBLA0A2G9I0L10.0A0A2G9I0L1_9LAMI; Uncharacterized protein
STRINGXP_004297083.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.10.0squamosa promoter-binding protein-like 12