PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678454719
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 271aa    MW: 30584.2 Da    PI: 5.7189
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678454719genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.61.5e-50101341128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lp+GfrFhPtdeelv++yL++k++++++ +  +++e+++yk++PwdLp ++  +ekewyfFs+rd+ky++g+r+nr++  gyWkatg dk++ +   ++v
  678454719  10 LPAGFRFHPTDEELVMHYLCRKCASRSIGV-PIVAEINLYKYDPWDLPGMALYGEKEWYFFSPRDRKYPNGSRPNRSAGCGYWKATGADKPIGN--PKTV 106
                799************************999.78***************6666689*************************************98..778* PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kk Lvfy+g+apkg+kt+W+mheyrl
  678454719 107 GIKKALVFYSGKAPKGVKTNWIMHEYRL 134
                **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-614159IPR003441NAC domain
PROSITE profilePS5100558.91910159IPR003441NAC domain
PfamPF023654.2E-2711134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MTTAAVDLQL PAGFRFHPTD EELVMHYLCR KCASRSIGVP IVAEINLYKY DPWDLPGMAL  60
YGEKEWYFFS PRDRKYPNGS RPNRSAGCGY WKATGADKPI GNPKTVGIKK ALVFYSGKAP  120
KGVKTNWIMH EYRLADVDRK KSNGSLRLDD WVLCRIYNKK GNIERQRGNK RPTTETTTTT  180
TDNDENEHVS VTTAAMAYDD CLYLDGSESI PSSSDHPSPE SASFQKAAES EWENFLLEGY  240
PDFQGYNPVD DTQDTIVGFS DYISKPFEIL A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-8041659174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011069419.11e-117PREDICTED: NAC domain-containing protein 2
SwissprotQ390131e-105NAC2_ARATH; NAC domain-containing protein 2
TrEMBLA0A022QWP81e-115A0A022QWP8_ERYGU; Uncharacterized protein
STRINGGLYMA02G26480.11e-108(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12392481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-103NAC family protein