PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678454619
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 992aa    MW: 109786 Da    PI: 6.7923
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678454619genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.23.5e-41160237178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +CqvegC+adls+ak+yhrrhkvC+vhska+++lv  ++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  678454619 160 VCQVEGCRADLSSAKDYHRRHKVCDVHSKASTALVGSIMQRFCQQCSRFHVLEEFDEGKRSCRRRLAGHNKRRRKAHP 237
                6**************************************************************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-31154222IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.385158235IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.1E-37159238IPR004333Transcription factor, SBP-box
PfamPF031101.4E-29161234IPR004333Transcription factor, SBP-box
SuperFamilySSF484033.73E-10726877IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.206.4E-9728879IPR020683Ankyrin repeat-containing domain
CDDcd002043.68E-8770869No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 992 aa     Download sequence    Send to blast
MTCGNTGFSQ MEAKFGRNLH RLCEPVVSDL NGVGKRSIEW DLNEWRWDGD FLRASPLNPV  60
PSDCSSRHPF GPDIPVKNAS LNFLASSSVE AILEDGREKR DSEKRRRYID VNEEHENGEA  120
GSLDLMLGDQ VFPIVDKDAD KSEKSGKKSN LCGEQSSRAV CQVEGCRADL SSAKDYHRRH  180
KVCDVHSKAS TALVGSIMQR FCQQCSRFHV LEEFDEGKRS CRRRLAGHNK RRRKAHPENA  240
VGSTAVNDEQ RTKYLLISLL RILSNIQSSS SDQTKDQDLL AHLLRNLATV SGSTNISNPN  300
GLLPVSPDLQ NAGTSCGKTI RENGSSDERP LPLPQTGLVS KDTLTDSAQV GAARVSTALC  360
NAMPSAKSIG CEGRVKMSNI DLNNVYDDSE DCTEDLVDNI PLENVSPYVS PWSFKDSQRS  420
SPPQSQSPST SSGEAQSRTD RIVFKLFGKD PSDFPLELRK QMIDWLSSSP SDIESYIRPG  480
CIILTIYACM DKSSWDELNC NLHSSLKRLL DASSNPFWTT DWIYTRVQHR ASFVYNGSIK  540
LYTLYTPLHV ALLMIALESC RISMISPIAV SFSETVHFSV KGYNLSGSTS RLLCALEGRY  600
ILQQSCADVV GADSYADNGG IQCLQFSCAV PHVVGRGFIE VEDYCLNSSF FPFIVAEKDV  660
CAAICDLEKI IDVDSENLDP DKTEARNQAL NFVHEMGWLL HKNSLILRVG AMRDDVDLFS  720
FRRFKYLIEF AIDHGWPAVV RKLLNVVFDG TVDMGKGTSA VAALLDLGLL HRAARTNSIP  780
VVKLLLEYRS TRRIADAHKQ TDCSSFLFMP DSTGPCGLTP LHIAAGLDDA HDLIDALTED  840
PQSVGIGAWN SVRDHSGLTP HDYACLRGHY SYTHLVQKKQ LSKKHGGHVV IDVPGTQLDV  900
AITKQKMAGV SSKMAVFRTE KTMGEMMSCS KCEQMMSYGS PKPSVALYRP AMLSMVLIAA  960
VCVCAALLFK SSPEVVYLFR PFRWELLKYG AE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-301602341084squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1102107EKRRRY
Cis-element ? help Back to Top
SourceLink
PlantRegMap678454619
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020547976.10.0LOW QUALITY PROTEIN: squamosa promoter-binding-like protein 1
TrEMBLA0A2G9I0L10.0A0A2G9I0L1_9LAMI; Uncharacterized protein
STRINGVIT_05s0020g00700.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.10.0squamosa promoter-binding protein-like 12