PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678453798
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 535aa    MW: 58960.9 Da    PI: 6.4603
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678453798genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.84.9e-28154207155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                kpr++W+  LH++Fv av+qL G +kA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  678453798 154 KPRVVWSMVLHRKFVAAVNQL-GYDKAVPKRILDLMNVEGLTRENVASHLQKYRL 207
                79*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011012.564195IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23001.3E-41443No hitNo description
SuperFamilySSF521729.68E-1415102IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23008.9E-1155127No hitNo description
CDDcd001562.99E-55695No hitNo description
Gene3DG3DSA:1.10.10.602.1E-29151212IPR009057Homeodomain-like
PROSITE profilePS512949.933151210IPR017930Myb domain
SuperFamilySSF466891.34E-18152211IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-24154207IPR006447Myb domain, plants
PfamPF002499.2E-6156206IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 535 aa     Download sequence    Send to blast
MTAERFMGDF EEYPRGLRVL AVDDDLICLK LLKALLQKCQ YKVPDIAIAD RFDFAVLSAN  60
NDPKLVLKGV THGACDYLVK PVRFEELSNI WQHVIRRKKF VSTGQAGSID QATSIQQNCE  120
DHSSIHENQD VNVNRKRKDE DDDSEGDDPA SQKKPRVVWS MVLHRKFVAA VNQLGYDKAV  180
PKRILDLMNV EGLTRENVAS HLQKYRLYLK RISSDAKQAA ALNSQCIPSY AASLGDMYFS  240
AAGRHGTSAR SSYTTGEMLR RPDASSGLGS LRGLMPPSLI QLNHVNGLGT PLPCLPSITQ  300
NPSGSLNLDQ FQMNRHASDA VHIDQSRIYE ASNMLNGKRD AAGSSTCILN GPGAFRNHTS  360
HNLATFNSVG LGASILHDAV SKTQPSSLAY APFHSQLPAN TKGDCSFSAS PFLQNDTNHS  420
LNSAQAANQR WGVQDLDFDH GFHPGDPSNY DIGTTIRPTS TFTNTMQQSM SKNFPTQPGT  480
AANETFSLLQ TKSPDELMNR SYDPFEEMVA AMIKREEDEA VSSCDFELDD YAYGV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-24151213264ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084015.11e-134PREDICTED: two-component response regulator ARR12-like
SwissprotA2X1N22e-72ORR24_ORYSI; Two-component response regulator ORR24
STRINGSolyc07g005140.2.15e-87(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22582458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.13e-55response regulator 12