PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678453758
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 363aa    MW: 40306 Da    PI: 8.4837
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678453758genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.75.1e-41204280177
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                +Cq++gC+adl+ ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsrfh lsefD++krsCrrrLa+hn+rrrk+ 
  678453758 204 RCQAQGCNADLTYAKHYHRRHKVCEFHSKAATVITAGLTQRFCQQCSRFHLLSEFDNGKRSCRRRLADHNRRRRKPP 280
                6*************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-33199266IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.317202279IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.27E-38203281IPR004333Transcription factor, SBP-box
PfamPF031109.7E-31205278IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MPWNTGSPHL IPSTIRVLNF PLLLARIPKR GTELASLCLA HTDAMYICTC SGAESNSSSW  60
VEMLDYQWGN PSPMLLAVTG EESSSQVSNN AHVLDPYPGN FLLPEVQFAA APTNEAYLYH  120
HHQGISPGFF GFYEGVAQGA AMASGFVVVP KNEPEHWSFE SNSRIGLNLG FGGRTYFSSS  180
DDDFLNLLYH RSRIFDSGSV HAPRCQAQGC NADLTYAKHY HRRHKVCEFH SKAATVITAG  240
LTQRFCQQCS RFHLLSEFDN GKRSCRRRLA DHNRRRRKPP QPSSLDNSTK SRMETTPAAN  300
SASENLPSEV SSFFLQVSGS DGGGSAAKNL IGQPPTSRRR RRLTGVDERT VSFQGEEENY  360
RRV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-30197278384squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1261278KRSCRRRLADHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. Binds specifically to the 5'-GTAC-3' core sequence. Involved in development and floral organogenesis. Required for ovule differentiation, pollen production, filament elongation, seed formation and siliques elongation. Also seems to play a role in the formation of trichomes on sepals. May positively modulate gibberellin (GA) signaling in flower. {ECO:0000269|PubMed:12671094, ECO:0000269|PubMed:16095614, ECO:0000269|PubMed:17093870}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap678453758
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090046.12e-85squamosa promoter-binding-like protein 8
SwissprotQ8GXL32e-62SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLA0A2G9HWN03e-86A0A2G9HWN0_9LAMI; Uncharacterized protein
STRINGMigut.B01572.1.p3e-81(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48462341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.13e-54squamosa promoter binding protein-like 8
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Xing S, et al.
    SPL8 Acts Together with the Brassinosteroid-Signaling Component BIM1 in Controlling Arabidopsis thaliana Male Fertility.
    Plants (Basel), 2013. 2(3): p. 416-28
    [PMID:27137384]