PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678453695
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family CPP
Protein Properties Length: 543aa    MW: 58925.4 Da    PI: 7.2211
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678453695genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR24.17.1e-081081321641
        TCR  16 kYCeCfaagkkCseeCkCedCkNkee 41 
                 YCeCfa+g +C+  C+C +C+N+ +
  678453695 108 TYCECFASGIYCDG-CNCVNCHNNVD 132
                5*************.********986 PP

2TCR51.42.2e-16176215140
        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  678453695 176 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNYE 215
                589***********************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.3E-488133IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163430.11198216IPR005172CRC domain
PfamPF036381.9E-5108130IPR005172CRC domain
SMARTSM011146.2E-20176217IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.5E-12179214IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MDQIEGGRLP PTNQLPSLSE ASSTAAVDFS ARKLVRQLDF TGFGSGPTGA EQQQMAKPIL  60
PPHQPPMPHM VKPAQSTKIP PQQMPFMGIQ NPCQLSGPLS NSLVRPLTYC ECFASGIYCD  120
GCNCVNCHNN VDNEAARREA VGATLERNPN AFRPKIASSP HGARDSRDEE GLATGKHNKG  180
CHCKKSGCLK KYCECFQANI LCSENCKCMD CKNYEGSEER QALFHGDHAN MAFVQQAANA  240
AITGAIGSSG FGSPPYNKKR NGQDLLFGST LKDPISKFGQ FHQANHNEKT CIPSSSASSA  300
PADRPGGPPG RGPSKFAYRS LLADIIQPQD LKELCSVLVV YSGQTAKMLA GEGDVDKQAE  360
DLRVMYASTL QTSELPTHDK NPNDTSSFDD QTEKAGPEKC YSHGADLSKG RPVSPSTAAL  420
MCDEKDAMFT VSPKRLEVEN NMSYELPRER VVTKSYAEQE RIVLTKFREC LNRLITLGEI  480
KETRYSALLP TESANEKETT SSILKTNSKD VQSISNGLVN LPISLGASAV AVRNPSFLEN  540
QHV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-259022511132Protein lin-54 homolog
5fd3_B1e-259022511132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678453695
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093606.10.0protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD11e-145TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A2G9GSN40.0A0A2G9GSN4_9LAMI; Metallothionein-like protein
STRINGXP_006451190.11e-175(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24012455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-123Tesmin/TSO1-like CXC domain-containing protein