PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678452938
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 219aa    MW: 25325 Da    PI: 9.1386
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678452938genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1622.3e-50131351128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrFhPtdeelv +yLk+kv + +l++ ++i+e+d+++++PwdLp     +e+e yfFsk++ ky++g+r+nrat+ gyWkatg dk++++ ++++v
  678452938  13 LPPGFRFHPTDEELVLQYLKRKVFSFPLPA-SIIPEFDVNRCDPWDLP---GDKEQERYFFSKKEVKYPNGNRSNRATACGYWKATGLDKQIVV-RNRVV 107
                79****************************.89***************...4467899************************************.8999* PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kktLvfy  + pkg+kt+Wvmheyrl
  678452938 108 GMKKTLVFYLRKPPKGSKTEWVMHEYRL 135
                **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-589156IPR003441NAC domain
PROSITE profilePS5100554.66913156IPR003441NAC domain
PfamPF023651.2E-2714135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MEKPPAGLPT RRLPPGFRFH PTDEELVLQY LKRKVFSFPL PASIIPEFDV NRCDPWDLPG  60
DKEQERYFFS KKEVKYPNGN RSNRATACGY WKATGLDKQI VVRNRVVGMK KTLVFYLRKP  120
PKGSKTEWVM HEYRLQNAAH ETPAETNWVV CRMLMKKRGS MKGELGNQKE GIVFYDFLAK  180
EKADSSCGSS GVTQLLIRKQ DEEEEEEDES SSCNSFFMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-481316217171NAC domain-containing protein 19
4dul_A2e-481316217171NAC domain-containing protein 19
1ut7_B2e-481316217171NO APICAL MERISTEM PROTEIN
1ut7_A2e-481316217171NO APICAL MERISTEM PROTEIN
1ut4_B2e-481316217171NO APICAL MERISTEM PROTEIN
1ut4_A2e-481316217171NO APICAL MERISTEM PROTEIN
3swp_D3e-481316220174NAC domain-containing protein 19
3swp_C3e-481316220174NAC domain-containing protein 19
3swp_B3e-481316220174NAC domain-containing protein 19
3swp_A3e-481316220174NAC domain-containing protein 19
3swm_D3e-481316220174NAC domain-containing protein 19
3swm_C3e-481316220174NAC domain-containing protein 19
3swm_B3e-481316220174NAC domain-containing protein 19
3swm_A3e-481316220174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086848.19e-95PREDICTED: NAC transcription factor 25
SwissprotQ9FY932e-77NAC83_ARATH; NAC domain-containing protein 83
TrEMBLA0A0B2P6896e-92A0A0B2P689_GLYSO; NAC domain-containing protein 29
TrEMBLB2ZGQ76e-92B2ZGQ7_SOYBN; NAC domain protein
STRINGGLYMA18G53954.12e-91(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13872377
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.19e-76NAC domain containing protein 83