PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678452914
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family MIKC_MADS
Protein Properties Length: 200aa    MW: 22582.8 Da    PI: 9.1809
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678452914genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF854.4e-27959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krie+ks rqvtf+kRrng+lKKA+ELSvLCd++v viifss+gk y y+s
  678452914  9 KRIEDKSARQVTFAKRRNGLLKKAKELSVLCDVDVGVIIFSSRGKPYHYCS 59
               79**********************************************996 PP

2K-box36.32.3e-1311617442100
      K-box  42 dLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                ++++ s+ +L++Le+qLe +l + R+ K++ lle+i+ l  k k+l ee+ +L+++++e
  678452914 116 SVDEFSITDLMHLEKQLEIALFQTRAAKTHALLESIKGLHDKGKKLAEEKGSLEEQIAE 174
                67899**************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.002161IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-38160IPR002100Transcription factor, MADS-box
CDDcd002652.40E-37278No hitNo description
SuperFamilySSF554559.81E-30280IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-25323IPR002100Transcription factor, MADS-box
PfamPF003193.3E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-253859IPR002100Transcription factor, MADS-box
PROSITE profilePS512978.12281178IPR002487Transcription factor, K-box
PfamPF014868.5E-10116172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MGRRKREIKR IEDKSARQVT FAKRRNGLLK KAKELSVLCD VDVGVIIFSS RGKPYHYCST  60
TSFSDLLLQY QSYAENGQCA ATGTRQGGAE QRSKNSGSLS RNGFLDTLEK ELCEPSVDEF  120
SITDLMHLEK QLEIALFQTR AAKTHALLES IKGLHDKGKK LAEEKGSLEE QIAEIKRKRI  180
GSNKLLMDLN VLAEDQMMDW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A6e-19175174MEF2 CHIMERA
6byy_B6e-19175174MEF2 CHIMERA
6byy_C6e-19175174MEF2 CHIMERA
6byy_D6e-19175174MEF2 CHIMERA
6bz1_A6e-19175174MEF2 CHIMERA
6bz1_B6e-19175174MEF2 CHIMERA
6bz1_C6e-19175174MEF2 CHIMERA
6bz1_D6e-19175174MEF2 CHIMERA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap678452914
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086821.14e-73MADS-box transcription factor 7-like isoform X1
TrEMBLA0A1S3X7B11e-57A0A1S3X7B1_TOBAC; agamous-like MADS-box protein AGL27 isoform X1
TrEMBLA0A1U7XSL91e-57A0A1U7XSL9_NICSY; agamous-like MADS-box protein AGL27 isoform X1
STRINGXP_009795052.12e-58(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.28e-28MIKC_MADS family protein