PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678452911
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family MIKC_MADS
Protein Properties Length: 231aa    MW: 26426.9 Da    PI: 8.7726
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678452911genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.62.5e-31959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gkly+++s
  678452911  9 KRIENKINRQVTFAKRRNGLLKKAHELSVLCDAEVALIIFSNRGKLYDFCS 59
               79***********************************************96 PP

2K-box94.61.7e-318617610100
      K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                 +a + s+qqe+ kLk+++e+Lqr+qR+llGedL++L+ keL++Le+qL++slk+iRs++++ +l+ + +lq++e++l+e+n++L+++l+e
  678452911  86 RAALELSSQQEYLKLKARYESLQRTQRNLLGEDLGPLNSKELESLEKQLDSSLKQIRSTRTQAMLDALTDLQRQEHALNEANRTLKQRLME 176
                44445689*******************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.221161IPR002100Transcription factor, MADS-box
CDDcd002651.17E-43272No hitNo description
SuperFamilySSF554551.19E-32275IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003197.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-323859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129714.1790180IPR002487Transcription factor, K-box
PfamPF014861.1E-2492174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAHELSVLCD AEVALIIFSN RGKLYDFCSS  60
SSNMMKTLER YQMSNYGAPD TNSSTRAALE LSSQQEYLKL KARYESLQRT QRNLLGEDLG  120
PLNSKELESL EKQLDSSLKQ IRSTRTQAML DALTDLQRQE HALNEANRTL KQRLMEGSQI  180
SLQWDGHHHP QQDVFYHPIE CEPTLQIGYQ PEHMAAAGPS VNSGYITSWM L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A5e-42761771104Developmental protein SEPALLATA 3
4ox0_B5e-42761771104Developmental protein SEPALLATA 3
4ox0_C5e-42761771104Developmental protein SEPALLATA 3
4ox0_D5e-42761771104Developmental protein SEPALLATA 3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678452911
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086825.11e-137agamous-like MADS-box protein AGL9 homolog
SwissprotQ8LLR01e-130MADS4_VITVI; Agamous-like MADS-box protein MADS4
TrEMBLQ387351e-133Q38735_ANTMA; DEFH72 protein
STRINGXP_009797140.11e-130(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.11e-110MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]