PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678452905
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 333aa    MW: 36995.8 Da    PI: 7.6187
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678452905genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.17.8e-4124100278
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                C v+gC adls +++yhrrhkvCevhsk+p v+++g+eqrfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+q+
  678452905  24 CLVDGCVADLSLCRDYHRRHKVCEVHSKSPRVMIEGREQRFCQQCSRFHSLAEFDEGKRSCRKRLEGHNRRRRKPQP 100
                **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-331785IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.3422198IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-3822103IPR004333Transcription factor, SBP-box
PfamPF031101.2E-302497IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MESSSSGTSK RAKAPSSSNQ IPHCLVDGCV ADLSLCRDYH RRHKVCEVHS KSPRVMIEGR  60
EQRFCQQCSR FHSLAEFDEG KRSCRKRLEG HNRRRRKPQP ESLIQNPGFL FANQSSYSGS  120
RILSFGDQQI LPSSVVPPKI WPGLSKVEND MSPYGGNQHQ VMEYNQRPDA FLKFPSYSSF  180
KGPHDDHHHH HHLHFHESSS SSSSALRNPS FFSEGLNHQV VDCDRALSLL SPASEAAHEF  240
TLNITGTGAE PLHSSQQPSL VRDYSYHNFS LLHHHFPEES KAGVAAAGSA SQYHDSHAPS  300
AAHVPEMFHH GEGSSSGATG SHQTLSFMWG GVE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-281597284squamosa promoter binding protein-like 4
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18097KRSCRKRLEGHNRRRRKP
Cis-element ? help Back to Top
SourceLink
PlantRegMap678452905
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022881716.13e-84squamosa promoter-binding-like protein 16
RefseqXP_022881717.13e-84squamosa promoter-binding-like protein 16
RefseqXP_022881718.13e-84squamosa promoter-binding-like protein 16
RefseqXP_022881719.13e-84squamosa promoter-binding-like protein 16
RefseqXP_022881720.13e-84squamosa promoter-binding-like protein 16
RefseqXP_022881721.13e-84squamosa promoter-binding-like protein 16
RefseqXP_022881722.13e-84squamosa promoter-binding-like protein 16
TrEMBLA0A2G9FXF52e-87A0A2G9FXF5_9LAMI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49202037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.19e-48SBP family protein