PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678452753
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family MIKC_MADS
Protein Properties Length: 208aa    MW: 24348 Da    PI: 7.2163
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678452753genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.61.1e-30959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krien+snrqvt+skRrngi+KKA+E+SvLCda+v+viif+s+gk++e++s
  678452753  9 KRIENSSNRQVTYSKRRNGIMKKAKEISVLCDAKVSVIIFASSGKMHEFCS 59
               79***********************************************96 PP

2K-box77.63.2e-2671167197
      K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                y+k sgk+l++ak+e+l++e++++kke++++q e+Rh++Ged+++L++keL+ Le++Le++++  ++k++e+++++ ++  + e+e+q+ + +L + 
  678452753  71 YHKLSGKRLWDAKHEHLDNEINRVKKENDSMQIELRHMKGEDISTLNYKELMVLEDALENGMSALKAKQMEVVRMMRKHNEMIEEENQSLQFKLLEP 167
                7899*********************************************************************999999999999999988888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.394161IPR002100Transcription factor, MADS-box
SMARTSM004323.0E-41160IPR002100Transcription factor, MADS-box
CDDcd002651.62E-41280No hitNo description
SuperFamilySSF554553.53E-36296IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-28323IPR002100Transcription factor, MADS-box
PfamPF003194.7E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-283859IPR002100Transcription factor, MADS-box
PfamPF014868.9E-1683164IPR002487Transcription factor, K-box
PROSITE profilePS5129713.03284170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MGRGKIEIKR IENSSNRQVT YSKRRNGIMK KAKEISVLCD AKVSVIIFAS SGKMHEFCSP  60
TTTLVDVLDQ YHKLSGKRLW DAKHEHLDNE INRVKKENDS MQIELRHMKG EDISTLNYKE  120
LMVLEDALEN GMSALKAKQM EVVRMMRKHN EMIEEENQSL QFKLLEPMEE NLIENQGVYD  180
HQAIADYESQ MPFTFRVQPM QPNLQQRF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A7e-17175173MEF2 CHIMERA
6byy_B7e-17175173MEF2 CHIMERA
6byy_C7e-17175173MEF2 CHIMERA
6byy_D7e-17175173MEF2 CHIMERA
6bz1_A8e-17175173MEF2 CHIMERA
6bz1_B8e-17175173MEF2 CHIMERA
6bz1_C8e-17175173MEF2 CHIMERA
6bz1_D8e-17175173MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the genetic control of flower development. Acts in conjunction with DEFICIENS (defA).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap678452753
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011081947.11e-140floral homeotic protein GLOBOSA
SwissprotQ033781e-136GLOB_ANTMA; Floral homeotic protein GLOBOSA
TrEMBLQ2PF141e-138Q2PF14_VERHY; GLOBOSA homologue
STRINGMigut.A00326.1.p1e-135(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46802139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.13e-81MIKC_MADS family protein
Publications ? help Back to Top
  1. Tröbner W, et al.
    GLOBOSA: a homeotic gene which interacts with DEFICIENS in the control of Antirrhinum floral organogenesis.
    EMBO J., 1992. 11(13): p. 4693-704
    [PMID:1361166]
  2. Gallois JL, et al.
    Functional characterization of the plant ubiquitin regulatory X (UBX) domain-containing protein AtPUX7 in Arabidopsis thaliana.
    Gene, 2013. 526(2): p. 299-308
    [PMID:23747397]
  3. Davies B,Egea-Cortines M,de Andrade Silva E,Saedler H,Sommer H
    Multiple interactions amongst floral homeotic MADS box proteins.
    EMBO J., 1996. 15(16): p. 4330-43
    [PMID:8861961]