PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678452142
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 401aa    MW: 44152.6 Da    PI: 4.7949
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678452142genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1092.4e-34176230155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                k+r+rWtpeLHe Fveav++LGGsekAtPk +l+lm+v+gLt++hvkSHLQkYR+
  678452142 176 KQRMRWTPELHETFVEAVNKLGGSEKATPKGVLKLMNVDGLTIYHVKSHLQKYRT 230
                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.33173233IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-31175231IPR009057Homeodomain-like
SuperFamilySSF466891.79E-18175230IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-25176230IPR006447Myb domain, plants
PfamPF002496.8E-11178229IPR001005SANT/Myb domain
PfamPF143792.7E-24262307IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MEAKPVGHIF SSCAGFSTDL HTSSIRQPEK HLRESAFISQ LKSGGESVVL PQCADSRVLQ  60
SNLLNQGSWS TDRFPDVLET PMSHSLQGSD EIAVAFEDLS KSNDWQEWAD QLLITDNDAV  120
AVDWSGLLVD AKAPSLEQVE APKPLVKISI QQPPGGPGEP SNSNGQSASP AAALPKQRMR  180
WTPELHETFV EAVNKLGGSE KATPKGVLKL MNVDGLTIYH VKSHLQKYRT ARFKPETPDE  240
SSEKKPASVQ ELPSLDLKAS IDLSEALRLQ MEVQKRLHEQ LEIQRNMQLR IEEQGRYLQM  300
MFEKQCMSGI DSVKGASSDD SENPFKGMKI KDPLPDSSDK LGEKSDAKET ECGDLAKEYQ  360
ETSQVAEEEQ DTLPVECIKA CTDAAPSPKR RKGNDSSPVT L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012830829.11e-143PREDICTED: protein PHR1-LIKE 1-like isoform X1
SwissprotQ8GUN56e-75PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A022S2541e-143A0A022S254_ERYGU; Uncharacterized protein
STRINGVIT_07s0005g04120.t011e-116(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27532349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.12e-81phosphate starvation response 1