PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678451266
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 501aa    MW: 55597.8 Da    PI: 4.4859
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678451266genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM99.26e-3148051128
        NAM  51 vkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                +++++++w+fFs+rd+ky++g r+nrat +gyWkatgkd+ + + ++++ g+kktLvfy+grap+g +tdWvmhey+l
  678451266   4 LRTGDRQWFFFSPRDRKYPNGARSNRATGHGYWKATGKDRIISC-GSRAAGIKKTLVFYRGRAPRGDRTDWVMHEYTL 80 
                457899************************************99.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100538.1051103IPR003441NAC domain
SuperFamilySSF1019411.02E-364103IPR003441NAC domain
PfamPF023654.4E-141080IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MSKLRTGDRQ WFFFSPRDRK YPNGARSNRA TGHGYWKATG KDRIISCGSR AAGIKKTLVF  60
YRGRAPRGDR TDWVMHEYTL DEEELKRCAT AKEYYALYKV FKKSGPGPKN GEQYGAPFRE  120
EDWDKEDLEV HPFIVGENPV TKSADDTMPI KEIMPKNGQY LSSLDDLREF MNQIEDEPIT  180
YGQLVAEQGT ETNLVEHAAR DVLPPVPHTF IQRIDEPASN FNQTDMTLLH LPETPEFSST  240
PALSVLDTGL TEEEIFGDKD FLEMDDLLCP CPATQYPVQP YGELLLDELD GLNEYDFQDA  300
SSILCDGGIS ESGQMAQGYS SSFGYDIGTM STVSSAAHQM QQHPTNVTEF SYTDGLSCSI  360
HAAESDQEIA LLSNPGFPHD NQSFDHVNLR ATAGAGENGI NQEDDGNDSW FSSALWSYME  420
SIPTTPASAS ERAFVNRALE RMSSFSGLRL NTRYMNVVSG NNVLPSTGKG RTSCLLLLVS  480
LLGVFCAAIW MFGGTPVRSV G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-32710969171NAC domain-containing protein 19
4dul_A3e-32710969171NAC domain-containing protein 19
1ut7_B3e-32710969171NO APICAL MERISTEM PROTEIN
1ut7_A3e-32710969171NO APICAL MERISTEM PROTEIN
1ut4_B3e-32710969171NO APICAL MERISTEM PROTEIN
1ut4_A3e-32710969171NO APICAL MERISTEM PROTEIN
3swp_D3e-32710972174NAC domain-containing protein 19
3swp_C3e-32710972174NAC domain-containing protein 19
3swp_B3e-32710972174NAC domain-containing protein 19
3swp_A3e-32710972174NAC domain-containing protein 19
3swm_D3e-32710972174NAC domain-containing protein 19
3swm_C3e-32710972174NAC domain-containing protein 19
3swm_B3e-32710972174NAC domain-containing protein 19
3swm_A3e-32710972174NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074131.11e-174PREDICTED: protein FEZ-like
TrEMBLA0A022R8F51e-135A0A022R8F5_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32122451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-89NAC domain containing protein 17