PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678450216
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 234aa    MW: 26054.1 Da    PI: 4.6722
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678450216genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like78.39.4e-253993156
    G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56
               kpr+ W  +LHe Fv+av+++ G e+A Pk+il  m+v+gLt+ehv+SHLQkYR +
  678450216 39 KPRISWDAKLHEIFVNAVNKI-GFENASPKKILVEMNVPGLTREHVASHLQKYRKH 93
               79*******************.9*******************************76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.7263695IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.2E-253794IPR009057Homeodomain-like
SuperFamilySSF466892.96E-163794IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-223993IPR006447Myb domain, plants
PfamPF002491.8E-74391IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MYSGGVAEQA VPKPMQTDGT PQSSRGGAHN MYVGETSNKP RISWDAKLHE IFVNAVNKIG  60
FENASPKKIL VEMNVPGLTR EHVASHLQKY RKHMTAKRVQ KNRILSGNGS TFIEQQPNSS  120
APPPCSQVEP CVTTPPAEQQ HAAPRLAQNP IMDFNCLQEE QHSQSNDNTF EAMYEDQILP  180
DISIAREYTL EDIVVMDESG EPFLTESEAP PLPRSTSLED DYVCLSPLWE SVDF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1975523
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.12e-19response regulator 1