PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678450009
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family CPP
Protein Properties Length: 565aa    MW: 61405.3 Da    PI: 6.8084
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678450009genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR23.51.1e-071081331642
        TCR  16 kYCeCfaagkkCseeCkCedCkNkeek 42 
                +YCeCfa+g +C+  C+C +C+N+ e+
  678450009 108 MYCECFASGIYCDG-CNCVNCHNNVEN 133
                6*************.********9875 PP

2TCR512.9e-16176215140
        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  678450009 176 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 215
                589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5163430.40397216IPR005172CRC domain
SMARTSM011140.0022108133IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.0E-5108130IPR005172CRC domain
SMARTSM011148.4E-20176217IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-12179214IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MDQREGGELP PNNPPPSVSE SYSTAVVDFP ARKLVRQLDF TDISSGPSAV EQQQTAKPIQ  60
PPPQSPIPQM AKPIQSTKLP PQQMPFMGIQ NPSQLPGPLN NSVTRPFMYC ECFASGIYCD  120
GCNCVNCHNN VENEAARREA VGATLERNPN AFRPKIASSP HGARDSRDED GLATGKHNKG  180
CHCKKSGCLK KYCECFQANI LCSENCKCMD CKNFEGSEER QALFHGDHAN MSFIQQAANA  240
AITGAIGSSG FGTLPYNKKR KGQDLCFGST LKDPVSKLGQ FQQASHNDRA SIPSSSTPAV  300
RPGGIPGRGP SKFAYRSLLA DIIQPQDLKE LCSVLVVYSG QTAKMLAVKK KKDHLPISVE  360
LYVADGVLLM VTDERDVEKQ AENLRAAPTS ILQTSEPSTH EKTPNDASSF DDQAEKTGPE  420
EFYSDGADSS KGRPVSPSTA ALMCDEKDAM FTASPKRLEV DNNMSSQLPL ERGVTKSYAE  480
QERIVLTKFR ECLNRLITLG EIKETRYSSL LQTESANEKE LTSSLPVSDS KDVQPLSNGL  540
ANLPISLRTA AVAVSIASFL ENKHI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-2610822524132Protein lin-54 homolog
5fd3_B2e-2610822524132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap678450009
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093606.10.0protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD11e-145TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A2G9GSN40.0A0A2G9GSN4_9LAMI; Metallothionein-like protein
STRINGGorai.001G006500.11e-178(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24012455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-134Tesmin/TSO1-like CXC domain-containing protein